KEGG   Alkaliphilus metalliredigens: Amet_0358Help
Entry
Amet_0358         CDS       T00551                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt00520  Amino sugar and nucleotide sugar metabolism
amt00550  Peptidoglycan biosynthesis
amt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Amet_0358
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Amet_0358
Enzymes [BR:amt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Amet_0358
Peptidoglycan biosynthesis and degradation proteins [BR:amt01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Amet_0358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ABR46588
JGI: Amet0358
UniProt: A6TK70
Position
394175..395428
Genome map
AA seq 417 aa AA seqDB search
MGKIIVEKSGPLQGTIRVSGAKNSVLPILAASLLATEQCTLEDVPALKDVEVICEVLTSL
GADVRRISRDKIEVSAADIDNFEAPYELVRKMRASFLVMGPLLARLGKARISMPGGCAIG
TRPIDLHLKGFKALGAKITMGHGFVEAKADQLIGSRIYLDFPSVGATENIMMAAVLAKGQ
TVIENAAEEPELIDLANFLNKMGADVRGAGTDTIKINGVDKLGGAVHPVIPDRVEAGTYM
IAAAITGGNLFIDNVMVDHLKPIMAKLRECNIEVSEEGNGVRVIAENRPKAVDIKTMPYP
GFPTDMQAQFMALMCVAEGTSVITETVFENRFMHVSELKRMGADIKIEGRSTVIEGRTDL
QGAPVKATDLRAGAALILTGLVSEGKTEISDIYHIDRGYVDIEEKLRNVGAIIYREE
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgggcaaaatcattgtagaaaaaagtggaccattacaaggaaccattcgggtaagtggc
gctaaaaattcagttttaccgattctagccgcctccttattagccacagaacaatgtaca
ctagaagacgttcctgccctcaaagatgtagaagtcatttgtgaagtactcacatcctta
ggcgccgacgtaagaaggatttccagggataaaatagaagtgagtgctgcagatattgat
aattttgaagcaccctatgaattagtgagaaaaatgagagcgtcctttttagtcatggga
ccattattagctcgattagggaaggctcgaatttcaatgcctggagggtgtgccattggc
accagacctattgacctgcatttaaaagggtttaaagcattaggagcaaagattacaatg
gggcatggctttgtagaagcaaaggcagaccagttaataggaagtcgtatttatttagat
tttcccagtgttggggcaacagagaatattatgatggctgcagttttagctaaggggcag
acagttattgaaaatgctgctgaagagccagagttaatcgacctagccaactttttaaac
aaaatgggtgctgatgtgagaggcgctggaacagataccattaagattaatggggtagac
aaattaggaggcgctgttcatccagtgattccagatagagtggaagcaggaacctatatg
attgcggcagccattaccggaggaaacctattcatcgataacgtgatggtagatcatctc
aagcctatcatggctaagctcagggaatgtaatattgaagtcagcgaagaaggaaatggt
gtccgggttattgcggaaaaccgtcctaaggcagtggatatcaaaaccatgccttatcca
gggtttcccacggatatgcaggcccagtttatggccttgatgtgtgttgctgaaggaacc
agtgtcattaccgaaaccgtatttgaaaatcgttttatgcatgtcagtgagctcaagaga
atgggtgctgacatcaaaatagaagggcgtagtactgtcattgaaggacggactgatctc
cagggagctcctgtaaaggcaacggatttaagggctggagcagccttgattttaacagga
cttgtatctgaaggtaaaacagagatctcagatatttatcatattgacagaggctatgtg
gatattgaagagaagctacgaaatgtaggagcaattatatatcgagaagaataa

DBGET integrated database retrieval system