KEGG   Alkaliphilus metalliredigens: Amet_0375Help
Entry
Amet_0375         CDS       T00551                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
amt  Alkaliphilus metalliredigens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:amt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Amet_0375
   00052 Galactose metabolism
    Amet_0375
   00500 Starch and sucrose metabolism
    Amet_0375
   00520 Amino sugar and nucleotide sugar metabolism
    Amet_0375
Enzymes [BR:amt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Amet_0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
413899..414822
Genome map
AA seq 307 aa AA seqDB search
MKVRKAVIPAAGLGTRFLPATKALPKEMLPIVDKPTLQYIIEEAVDSGIEEILIITGRNK
SSIENHFDKSIELELELEKKGKDELLKQVRAISDMVNIHYIRQKEPKGLGHAIHCAKSFI
GNEPFAVMLGDDIVENDKPCLEQMMEMYDEYKTTILGVQEVPKESVNKYGIVDGMHIEGG
IYKVKDLVEKPSPQEAPSNIAILGRYIINPEIFDILENTKPGKGGEIQLTDALKELAHRE
AMYAYVFEGRRHDVGDKQGFLEATVEFALKREDLREGFLNYLEDVVKKERESKALEEVAV
TTEQKSS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtacgtaaggcagtcataccagcagcgggattaggaacacgatttttaccggca
acaaaagcactacctaaagaaatgctaccgatcgtagacaagcctacattacaatatatt
attgaagaagctgtggattcaggtattgaagaaattctaattataacaggaagaaataaa
tcttccatagagaaccattttgataaatctatcgagcttgaactagaactagagaaaaaa
ggtaaagatgaattactaaagcaggtgagagcaatatcggatatggtgaatatccattac
ataagacaaaaagagcctaagggattaggtcatgcgatccactgtgcgaaaagctttatc
ggaaatgaaccctttgcagttatgctgggggatgatattgttgaaaatgataaaccttgt
ttggaacagatgatggagatgtatgacgagtataagaccacgatcctaggggtccaagaa
gtacctaaagagagtgtaaacaagtatggaatcgtagatggaatgcatattgagggtggc
atatacaaagtaaaggacttagtagaaaagccatctccccaggaagccccttctaatatt
gcaatcctaggaagatatattattaacccagagatatttgatatattggaaaataccaag
cctggaaagggtggagagatccaattaaccgatgccctaaaggaactagcccatagggaa
gccatgtatgcttatgtttttgaaggaagaaggcatgatgtgggagacaagcaggggttc
ttagaagcaactgtggagtttgctctgaaacgtgaagatctaagggaaggttttttaaac
tacctggaggatgttgtaaagaaggaaagagagagtaaggcattagaggaagttgccgta
acaaccgaacaaaagagcagttaa

DBGET integrated database retrieval system