KEGG   Alkaliphilus metalliredigens: Amet_0567Help
Entry
Amet_0567         CDS       T00551                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
amt  Alkaliphilus metalliredigens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:amt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Amet_0567
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Amet_0567
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Amet_0567
Enzymes [BR:amt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Amet_0567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
592441..593502
Genome map
AA seq 353 aa AA seqDB search
MWEGIISKYSSYFGVADGEKVITLNEGNTPLIAAENIGEMLGGIKLYLKYEGLNPTGSFK
DRGMTMAVSKAVEAGSKAIICASTGNTSAAAAAYAAKAGIQCFVLIPNKKIALGKLSQAV
IYGAKIIPVEGNFDDALRIVQEIAAEGRVTLVNSVNPYRLIGQRSGAYEVCEQLEGEIDY
LSIPVGNAGNISAYWAGFKDYFEAGKLKKLPVMLGFQAEGAAPIVENRIFENPETVATAI
RIGNPASWEKAVAARDDSKGLIDKVTDEEILSAQRLLASKEGIFVEPASAASVAGVIQLS
KKGYFKKGQKVVCVLTGNGLKDPSVVDVEKELKVYGVHTEEIKILINECLGGE
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaaggtatcatatcaaaatatagcagttattttggcgtagcagatggggaaaag
gtcattacgttaaatgaaggaaatacacctttaattgcagcagagaatataggagagatg
ctaggaggcatcaaattatatctgaaatatgaaggattaaatccaacgggatcctttaag
gacagagggatgaccatggcggtttctaaggctgtggaagcaggaagcaaagccattatc
tgtgcgtcaactggaaatacatcagcggcagcggcagcctatgctgcaaaggctggtata
caatgttttgtattaattcctaataaaaaaattgcacttggaaagctttcacaggccgtt
atttatggagctaagatcatacctgtagaggggaactttgatgatgccctacggattgta
caggagattgcggctgaaggaagggtgactctagtgaattcagttaacccctatcgttta
attggtcaaagatcaggggcttatgaggtttgtgagcaattagagggggaaattgactat
ttatctattcctgtagggaatgcaggtaatatctctgcctactgggcagggtttaaagat
tactttgaagcagggaaactgaaaaagttacctgtcatgctaggatttcaggctgagggg
gctgcacctatcgttgaaaatcgaattttcgaaaatccggagactgttgcaacggccatt
cgaattgggaaccctgccagctgggaaaaggcagtggctgcccgggatgattccaaagga
ctgatagataaggtaactgatgaagaaatattaagtgcccaaagactcttagcatcaaag
gaagggatttttgttgagccagcctctgctgccagtgtagctggggtcattcaacttagc
aaaaaaggttattttaaaaagggtcaaaaagtcgtatgcgtgttgacggggaatgggtta
aaggatccctctgtagtagatgtggagaaggaactcaaggtctatggcgtacatacggag
gaaataaaaatactcattaatgaatgtttaggaggagagtaa

DBGET integrated database retrieval system