KEGG   Alkaliphilus metalliredigens: Amet_0567Help
Entry
Amet_0567         CDS       T00551                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt00260  Glycine, serine and threonine metabolism
amt01100  Metabolic pathways
amt01110  Biosynthesis of secondary metabolites
amt01120  Microbial metabolism in diverse environments
amt01230  Biosynthesis of amino acids
Module
amt_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:amt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Amet_0567
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Amet_0567
Enzymes [BR:amt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Amet_0567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: ABR46794
JGI: Amet0567
UniProt: A6TKS6
Position
592441..593502
Genome map
AA seq 353 aa AA seqDB search
MWEGIISKYSSYFGVADGEKVITLNEGNTPLIAAENIGEMLGGIKLYLKYEGLNPTGSFK
DRGMTMAVSKAVEAGSKAIICASTGNTSAAAAAYAAKAGIQCFVLIPNKKIALGKLSQAV
IYGAKIIPVEGNFDDALRIVQEIAAEGRVTLVNSVNPYRLIGQRSGAYEVCEQLEGEIDY
LSIPVGNAGNISAYWAGFKDYFEAGKLKKLPVMLGFQAEGAAPIVENRIFENPETVATAI
RIGNPASWEKAVAARDDSKGLIDKVTDEEILSAQRLLASKEGIFVEPASAASVAGVIQLS
KKGYFKKGQKVVCVLTGNGLKDPSVVDVEKELKVYGVHTEEIKILINECLGGE
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaaggtatcatatcaaaatatagcagttattttggcgtagcagatggggaaaag
gtcattacgttaaatgaaggaaatacacctttaattgcagcagagaatataggagagatg
ctaggaggcatcaaattatatctgaaatatgaaggattaaatccaacgggatcctttaag
gacagagggatgaccatggcggtttctaaggctgtggaagcaggaagcaaagccattatc
tgtgcgtcaactggaaatacatcagcggcagcggcagcctatgctgcaaaggctggtata
caatgttttgtattaattcctaataaaaaaattgcacttggaaagctttcacaggccgtt
atttatggagctaagatcatacctgtagaggggaactttgatgatgccctacggattgta
caggagattgcggctgaaggaagggtgactctagtgaattcagttaacccctatcgttta
attggtcaaagatcaggggcttatgaggtttgtgagcaattagagggggaaattgactat
ttatctattcctgtagggaatgcaggtaatatctctgcctactgggcagggtttaaagat
tactttgaagcagggaaactgaaaaagttacctgtcatgctaggatttcaggctgagggg
gctgcacctatcgttgaaaatcgaattttcgaaaatccggagactgttgcaacggccatt
cgaattgggaaccctgccagctgggaaaaggcagtggctgcccgggatgattccaaagga
ctgatagataaggtaactgatgaagaaatattaagtgcccaaagactcttagcatcaaag
gaagggatttttgttgagccagcctctgctgccagtgtagctggggtcattcaacttagc
aaaaaaggttattttaaaaagggtcaaaaagtcgtatgcgtgttgacggggaatgggtta
aaggatccctctgtagtagatgtggagaaggaactcaaggtctatggcgtacatacggag
gaaataaaaatactcattaatgaatgtttaggaggagagtaa

DBGET integrated database retrieval system