KEGG   Alkaliphilus metalliredigens: Amet_0699Help
Entry
Amet_0699         CDS       T00551                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
amt  Alkaliphilus metalliredigens
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:amt01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:amt00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
744511..746202
Genome map
AA seq 563 aa AA seqDB search
MKILRINMTALEYIPQEVPLEYINLGGRGLTSKLLSEEVDPKSFALGRDNKIIIAPGLLS
GSMAPCSGRVSVGAKSPLTGGIKESNAGGTISQYLAGHDIKALVIEGQPSGKNWWVLVIN
GDEVKFEVRGDLQGLGNYETMNRLKQEYDSDCGIMSIGPAGEQGCTIASLAATDLEGRPT
RHAARGGLGAVLGSKGIKAIVIEKPEKMNKKGVHQEAFRETAKELAKSLVSGKAALTKYG
TAVLVNAINEVGGLPTNNYRTGYNQEAGQISGETLHELCQERGGTTGHPCHRGCAIRCSN
VFHDAQGEYVTAGLEYETIALLGSNCGVNNLDEIASLDYICDDLGLDTMDMGGALGVAME
AGVLEFGDYEAMKKSILSIVTGGDTLGKILGHGAALTGRVLGVERVPVVKGQTMAAYDPR
TLKGTGVTYATTPMGADHTAGNALPGRGGIDCKDPQGQTELSKKLQIISMVCDILGVCIF
VGPVEENMATFASLTSSFTGKEISVGGLLEEGRKILRTEVAFNEKAGLGKETNDLPGYFR
TEALPNNGLTFDVSSHELNEFKY
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcctaagaattaatatgactgccctagagtatataccacaggaagtcccttta
gaatatataaacctagggggacgggggttgacctctaagcttttatcagaggaagtagat
ccaaaatcctttgccttaggcagggataacaaaattatcattgcccctggactattaagt
ggcagcatggcaccttgtagtggcagggtatcggtaggagcaaaaagtccattgaccggg
ggcattaaggaaagtaatgcagggggaaccattagtcaatatctggcaggtcatgacatt
aaggccttggtgatagaaggtcaacccagtggaaaaaattggtgggttttagtgattaat
ggggatgaagtgaagtttgaagtcagaggggatttacagggattaggaaactatgaaacc
atgaatcgattaaagcaggaatatgactctgattgtgggattatgtctattggaccggcg
ggagagcaaggctgtaccattgcaagcttagctgcaacagatttagagggtagacctaca
cgtcacgctgctcggggagggctgggagccgttctgggaagtaaaggaatcaaagccatc
gttattgaaaagcctgagaagatgaataaaaaaggtgttcatcaagaagcatttagggaa
actgcaaaggaactagccaaaagcctagtcagtggaaaggctgctttaacaaaatatggc
actgcggtattggtcaatgcaatcaatgaagtgggaggactgcctactaataattatagg
actggatacaaccaagaggcaggacaaattagtggagagacactacatgaattatgccag
gaaagaggaggaaccactggacatccatgtcatagaggttgtgcaatccgctgctccaat
gttttccatgatgcccaaggagaatatgtcacagctggattagaatatgaaaccattgca
ttactaggatctaattgtggtgtcaataatctagatgaaattgcttccttagattatatt
tgtgacgatcttggattggataccatggacatgggtggtgcattaggtgtggccatggaa
gctggtgtgttagaatttggagattatgaggcaatgaaaaagtccatcttaagcattgtt
actggaggagacaccctaggtaaaatactaggacacggtgctgcattaaccggaagggtt
ttaggggttgaaagggtgccagtagtgaagggacagacaatggcagcctatgatccgaga
acactgaagggaacgggagtcacctatgcgacaacacccatgggagcagatcatacagct
ggcaatgcacttcctggaagaggtggaatcgactgtaaggacccacagggacagacggaa
ttatctaaaaaactacaaattatttcaatggtatgtgacatattaggggtttgtattttt
gtcggtcccgtggaggaaaacatggctacattcgcttccttaacgtctagcttcacagga
aaggaaatctctgtaggcggcctgctagaagagggtcgtaaaatattgaggacagaggta
gcctttaatgaaaaggcgggattaggtaaggaaacaaatgatttgccagggtattttaga
acagaggccttgccaaacaatggattaacctttgatgtttcttctcatgaactcaatgag
tttaaatattag

DBGET integrated database retrieval system