KEGG   Alkaliphilus metalliredigens: Amet_0699Help
Entry
Amet_0699         CDS       T00551                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt00030  Pentose phosphate pathway
amt01100  Metabolic pathways
amt01120  Microbial metabolism in diverse environments
amt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Amet_0699
Enzymes [BR:amt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Amet_0699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ABR46924
JGI: Amet0699
UniProt: A6TL56
Position
744511..746202
Genome map
AA seq 563 aa AA seqDB search
MKILRINMTALEYIPQEVPLEYINLGGRGLTSKLLSEEVDPKSFALGRDNKIIIAPGLLS
GSMAPCSGRVSVGAKSPLTGGIKESNAGGTISQYLAGHDIKALVIEGQPSGKNWWVLVIN
GDEVKFEVRGDLQGLGNYETMNRLKQEYDSDCGIMSIGPAGEQGCTIASLAATDLEGRPT
RHAARGGLGAVLGSKGIKAIVIEKPEKMNKKGVHQEAFRETAKELAKSLVSGKAALTKYG
TAVLVNAINEVGGLPTNNYRTGYNQEAGQISGETLHELCQERGGTTGHPCHRGCAIRCSN
VFHDAQGEYVTAGLEYETIALLGSNCGVNNLDEIASLDYICDDLGLDTMDMGGALGVAME
AGVLEFGDYEAMKKSILSIVTGGDTLGKILGHGAALTGRVLGVERVPVVKGQTMAAYDPR
TLKGTGVTYATTPMGADHTAGNALPGRGGIDCKDPQGQTELSKKLQIISMVCDILGVCIF
VGPVEENMATFASLTSSFTGKEISVGGLLEEGRKILRTEVAFNEKAGLGKETNDLPGYFR
TEALPNNGLTFDVSSHELNEFKY
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcctaagaattaatatgactgccctagagtatataccacaggaagtcccttta
gaatatataaacctagggggacgggggttgacctctaagcttttatcagaggaagtagat
ccaaaatcctttgccttaggcagggataacaaaattatcattgcccctggactattaagt
ggcagcatggcaccttgtagtggcagggtatcggtaggagcaaaaagtccattgaccggg
ggcattaaggaaagtaatgcagggggaaccattagtcaatatctggcaggtcatgacatt
aaggccttggtgatagaaggtcaacccagtggaaaaaattggtgggttttagtgattaat
ggggatgaagtgaagtttgaagtcagaggggatttacagggattaggaaactatgaaacc
atgaatcgattaaagcaggaatatgactctgattgtgggattatgtctattggaccggcg
ggagagcaaggctgtaccattgcaagcttagctgcaacagatttagagggtagacctaca
cgtcacgctgctcggggagggctgggagccgttctgggaagtaaaggaatcaaagccatc
gttattgaaaagcctgagaagatgaataaaaaaggtgttcatcaagaagcatttagggaa
actgcaaaggaactagccaaaagcctagtcagtggaaaggctgctttaacaaaatatggc
actgcggtattggtcaatgcaatcaatgaagtgggaggactgcctactaataattatagg
actggatacaaccaagaggcaggacaaattagtggagagacactacatgaattatgccag
gaaagaggaggaaccactggacatccatgtcatagaggttgtgcaatccgctgctccaat
gttttccatgatgcccaaggagaatatgtcacagctggattagaatatgaaaccattgca
ttactaggatctaattgtggtgtcaataatctagatgaaattgcttccttagattatatt
tgtgacgatcttggattggataccatggacatgggtggtgcattaggtgtggccatggaa
gctggtgtgttagaatttggagattatgaggcaatgaaaaagtccatcttaagcattgtt
actggaggagacaccctaggtaaaatactaggacacggtgctgcattaaccggaagggtt
ttaggggttgaaagggtgccagtagtgaagggacagacaatggcagcctatgatccgaga
acactgaagggaacgggagtcacctatgcgacaacacccatgggagcagatcatacagct
ggcaatgcacttcctggaagaggtggaatcgactgtaaggacccacagggacagacggaa
ttatctaaaaaactacaaattatttcaatggtatgtgacatattaggggtttgtattttt
gtcggtcccgtggaggaaaacatggctacattcgcttccttaacgtctagcttcacagga
aaggaaatctctgtaggcggcctgctagaagagggtcgtaaaatattgaggacagaggta
gcctttaatgaaaaggcgggattaggtaaggaaacaaatgatttgccagggtattttaga
acagaggccttgccaaacaatggattaacctttgatgtttcttctcatgaactcaatgag
tttaaatattag

DBGET integrated database retrieval system