KEGG   Alkaliphilus metalliredigens: Amet_1082Help
Entry
Amet_1082         CDS       T00551                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
amt  Alkaliphilus metalliredigens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Amet_1082
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Amet_1082
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Amet_1082
Enzymes [BR:amt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Amet_1082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1133724..1134926
Genome map
AA seq 400 aa AA seqDB search
MMKVKELPKKFGKFGGQFVPETLMNALIELERQFIQTKEDDEFQEMYRYYVREYSGRPTP
LYYAENLTKKLGGGKIYLKREDLNHTGAHKINNVIGQVLLARKMKKKRIIAETGAGQHGV
ATATICAMFDLECVVYMGAEDIERQALNVFKMEMLGAEVVSVTSGTATLKDATNEAIRDW
VANVKDTYYVIGSVVGPHPYPTMVRDFQRIIGDEVKEQILEKEGRLPNYLVACVGGGSNA
MGLFYPFYEDEAVALYGVEAAGLGVETDQHAATITKGSMGVIHGMMTYLLQDEQGQITPV
HSISAGLDYPGIGPEHAYYHHTGRANYVAITDEEALEAFQLLTRLEGIIPALESAHAIAY
LMKLAPKTKGDDIIVLNLSGRGDKDIHTISKLLGGNRDDK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagtaaaggaactacctaagaaatttggaaaatttggaggacaatttgtacca
gaaaccttaatgaatgcactcattgaattggagagacagtttatacaaaccaaggaagat
gatgaatttcaggaaatgtatcggtactatgtaagggagtattccggaagaccgacacct
ctatactatgctgaaaatttgaccaaaaaactggggggcgggaaaatttatcttaaacgg
gaggatttaaatcataccggggcccataagattaacaacgtgatcggacaggtgctattg
gcaaggaagatgaaaaaaaagcgtatcatagcagaaactggagccgggcagcatggtgtt
gctactgcaactatatgtgcaatgtttgatttagaatgtgttgtatatatgggagcagag
gatattgaaagacaggcgttaaatgtatttaaaatggagatgctaggggccgaggtcgtt
tctgtcacatctggaacagcaaccctaaaggatgccaccaacgaagccataagagattgg
gtggcaaatgtaaaggatacttattatgtaatcgggtcagttgtaggaccacacccctat
cccactatggtcagggattttcagaggattattggtgatgaagtgaaggagcagatatta
gaaaaagaaggaagacttccaaattatttagtggcatgtgtaggaggcggaagcaatgcc
atgggtcttttttatcccttttatgaagatgaagctgtggcgttgtatggagtggaggca
gcagggctaggtgtagagacggatcagcatgctgccaccatcacaaaggggagcatggga
gttattcacggtatgatgacttatctcctacaggatgaacaggggcaaattacaccggta
cattctatctcagcaggtttggattatccaggaatcgggccagagcatgcctattatcat
catactggtagagcaaattatgtagccattactgatgaagaggcattagaagcatttcaa
ttactaacaaggctagagggaattattccagcactagagagcgcccatgctattgcttac
ttaatgaagctagcacccaagacaaaaggcgatgatattattgttcttaatctttcggga
cggggggataaggatatccacaccatttcaaaattattagggggaaatagagatgataag
tag

DBGET integrated database retrieval system