KEGG   Alkaliphilus metalliredigens: Amet_1083Help
Entry
Amet_1083         CDS       T00551                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
amt  Alkaliphilus metalliredigens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Amet_1083
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Amet_1083
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Amet_1083
Enzymes [BR:amt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Amet_1083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1134916..1135716
Genome map
AA seq 266 aa AA seqDB search
MISRITNKLQALKEYDEKALITYVTAGDPDLETTFDLVLAMEKAGADIIELGIPYSDPLA
DGPVIQRASQRALNAGANMEAIFELVIKLREKTQIPLVFLVYYNCVFKYGLETFLNRCQE
IGIDGLIIPDLPLEERRELQVMMQQYPMDLIPLVAPTSEDRMKEIVQDAEGFIYCVSSTG
VTGKRNSLAGNLEGFMQQLRTYTEIPLVIGFGISNSEMMDKLKNICDGFIIGSAVIEKIE
AGLEDRSSVERVSKFIEKLYEFKNLG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgataagtagaataaccaataagttgcaggcattaaaagagtatgatgagaaggcgttg
ataacctatgttactgctggagatccagatttagagacaacatttgatttggtattggca
atggagaaggcaggagcagatataatagagttagggattccttattcagatcctttagct
gatggtcccgtcatacagagggcatctcaaagagcattaaatgctggggctaatatggaa
gctatttttgaattggtcataaaattaagggaaaaaacacaaattcccctggtgttttta
gtctattataactgtgtgtttaaatatggtctagagacgtttttaaatagatgtcaggaa
atcggcatagatggattgattattccagatcttcctctagaggagagaagagaactacaa
gtgatgatgcaacaatatccaatggacctaatccctttggttgcgcctacatctgaagat
agaatgaaggaaattgtacaggatgctgaaggatttatttactgtgtttcttctactgga
gttacaggaaaaagaaatagtcttgcaggaaatctggaaggctttatgcaacaattaaga
acctatacggagatccctttggtcataggttttggtatatcaaattctgagatgatggat
aaattaaaaaacatatgtgacggtttcattataggtagtgctgtgatagagaaaattgaa
gcgggtttagaggatagaagctcagtggaaagggtttctaaatttattgaaaagttatat
gaatttaaaaacttaggttga

DBGET integrated database retrieval system