KEGG   Alkaliphilus metalliredigens: Amet_1292Help
Entry
Amet_1292         CDS       T00551                                 

Definition
mannonate dehydratase (EC:4.2.1.8)
Orthology
K01686  
mannonate dehydratase [EC:4.2.1.8]
Organism
amt  Alkaliphilus metalliredigens
Pathway
Pentose and glucuronate interconversions
Metabolic pathways
Module
D-Glucuronate degradation, D-glucuronate => pyruvate + D-glyceraldehyde 3P
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:amt00040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1344324..1345391
Genome map
AA seq 355 aa AA seqDB search
MILRWFPDGDDSVTLEQIKQTPGVSGVATCLPKIPVGDVWELDVLEKLKKEINDAGLEME
VIESVNIHEDIKKGLPSRDKYINNYIKTIENLSKVGVKVLCYNFMPVIDWARSDLAHRIA
DGSSVMAYRHDEVVEMNPASMAEVMKKKARGYSLPGWEPERLKQMAIDIEIYKNMSTEAY
WENMKYFLDAVIPYAEKYDVQMAIHPDDPPWPLYGLPKVINNADNIRKFLRLNPSRYNGL
TLCTGSLGADSKNDIPAVIREFSGEGRIHFAHIRNLKHLSEKDFDESAHLSECGDLDMFE
VVKAYQDTDFDGYIRPDHGRMIWGEKARPGYGLYDRALGANYILGLWEAIEKMKK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgattttacgctggtttcctgatggagatgatagcgtgacattagagcagattaagcag
acaccaggagtatcaggagttgcaacatgtttgcccaagatacctgtgggggatgtttgg
gaactggatgttttagaaaagttgaaaaaagaaataaatgatgctggcttggagatggaa
gtaattgaaagtgtaaatatccacgaggatataaagaaaggacttccatctagagataaa
tatataaataattatataaaaaccatcgaaaatttatctaaagtgggtgtcaaggtttta
tgttataattttatgcctgtaattgattgggcacgaagtgatttagcccatcggattgca
gatggaagctcggttatggcatatagacatgatgaagtggtagaaatgaatccagctagc
atggcggaagtgatgaagaaaaaggccagaggttattccttgccaggctgggagccggaa
agactaaaacaaatggctatagatatagaaatttacaagaatatgtctactgaagcatat
tgggaaaatatgaaatatttcttggatgcagtgattccatatgctgaaaaatatgatgtt
cagatggctattcacccagatgatccaccgtggcctttatatggactaccaaaggtaatc
aacaatgcagataatatcagaaagttccttaggttgaatccaagtagatataacggtttg
actttatgtacaggaagcttaggtgccgattctaaaaatgatatcccggcagttattcgt
gagttttcaggagagggcagaatacattttgcacatatcagaaatctaaaacacctttct
gaaaaggattttgatgaatctgcacacttaagtgaatgtggcgacttggatatgttcgag
gttgtaaaggcatatcaggatactgatttcgatggctatataagaccagatcacggtaga
atgatttggggggaaaaggcccgaccaggttatggcttgtatgaccgtgccttgggtgca
aactacattttaggattatgggaagctattgaaaaaatgaaaaaataa

DBGET integrated database retrieval system