KEGG   Alkaliphilus metalliredigens: Amet_1301Help
Entry
Amet_1301         CDS       T00551                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
amt  Alkaliphilus metalliredigens
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Amet_1301
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Amet_1301
Enzymes [BR:amt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Amet_1301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1352180..1353484
Genome map
AA seq 434 aa AA seqDB search
MNWKIISMMVLIIFFATGLMACQQHNESTEEEETVLIIEEPQEGELQVEELEIEEIQIIE
GLIQEMTLEEKIGQLFMPAFRSDHEGRPLKKINESVKEQIKQYHLGGIILFAENIESIDQ
TKKLIDDMQKNSRLPMFIAVDEEGGRVTRLNHSRSQLPATQLPGNEVLGKTKDPTLSYEV
GRLLGRELLSLGFNMNLAPVADVNTNAKNPVIGDRSFSDNPQEVGIMASEMARGLQNENV
SAVFKHFPGHGDTEFDTHHQAVVINHDLERLQSVEWVPFRKGIEVSVDAIMTAHIQMPQI
TGNDFPATLSSKIITEILREEMGYEGMVITDALEMSAVSQHYTSAEAAVLAIEAGVDILL
MPRSLEEAYGGVLEAVSLGLITEERIEESVRRILQVKLKRGVLEGSQTKEDPFEVIGSAY
HAKIVKEIMNKLGR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaattggaaaatcatatcaatgatggttttaatcatattttttgccacgggtttgatg
gcatgtcagcaacacaacgagagtacagaggaagaagaaacagttttaatcatagaggaa
ccacaagaaggagaattacaagtagaagaattagaaatagaggaaatccagatcattgaa
gggttgattcaagagatgacattagaagaaaagataggtcagttgtttatgccagccttt
agaagtgatcatgaaggacgacctctaaagaaaataaatgaatcggtaaaagaacaaatc
aaacagtatcatttaggtggtatcatcttatttgctgaaaacattgaatcgattgaccag
acaaaaaaattgatcgatgacatgcaaaaaaacagtcgccttcctatgttcattgcagtc
gatgaggagggaggcagagtcacgcgattgaatcatagtcgatctcaacttcctgctact
caacttccaggaaatgaagtgctaggaaaaacaaaggatcccacactatcctatgaggta
gggcgattattgggaagagagctattatctcttggatttaatatgaatctagccccggtg
gcagatgtcaatacaaatgccaaaaatcccgtcataggagaccgttcctttagtgataat
ccccaagaagtaggaatcatggcaagtgagatggcgagaggattacaaaatgaaaatgta
agtgctgtattcaagcattttcctggacatggagatactgaatttgacacgcatcatcaa
gctgttgtcattaatcatgatttggagcggctacagtcggtagaatgggttccctttcgg
aagggaatcgaggtgagtgttgatgcaatcatgacggcccatatacaaatgccacaaata
acgggaaatgattttcccgccacgctgtctagcaagatcattacagaaatcctaagggag
gaaatgggatatgaagggatggtcattacggatgctttggaaatgtcagctgtttcccag
cattatacctcggcagaagcagcagtattagccattgaagcaggagtggatattcttttg
atgcctaggtcattagaggaggcctatgggggggtccttgaggcagtatcccttggtttg
atcactgaggaaagaatagaggaatcagttcgtaggattcttcaagttaagcttaaaaga
ggtgttttagagggatcccagactaaagaagacccatttgaggtgattggttctgcttac
catgcaaaaattgtgaaagaaataatgaataagctaggaagatag

  All links  
No link information was found.   
DBGET integrated database retrieval system