KEGG   Alkaliphilus metalliredigens: Amet_1365Help
Entry
Amet_1365         CDS       T00551                                 

Definition
cell cycle protein
Orthology
K05837  
rod shape determining protein RodA
Organism
amt  Alkaliphilus metalliredigens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1423511..1424644
Genome map
AA seq 377 aa AA seqDB search
MRIDHRLARKIDFGLIAVVLIICIIGVMMVGSATEGALSNRHIRTQIISVLIGIGAIIAI
MLIDYNSLSRMYIPIYILSNALLLAVLVMGTGQEQWGANRWIRIAGFQFQPADFAKIGII
ICLAKMIDDNKESIHKIPTLMKIIAFAGLPMLLIMRQPDLGTTMAFASFTFGMLFIAGLR
YKHILITGIMGVVSLPFMWFVVLKGYQQQRILTFLNPELDPQGAGYHIIQSKITVGAGRT
LGMRLENFLGINPPSTTFFHHFGFLPEKHTDFIFSVIAQELGFVGSIVLLILYAILLIKC
MNVAREAKDDFGKYIVTGITFMLAFHIIANIAMTIGLMPVTGKPLPFVSYGGTFMLSNMI
ALGLVLNVNMRRDKINF
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgaggattgatcatcgtttagctcgcaagattgactttggacttattgccgttgtattg
attatttgcattataggtgtcatgatggtaggaagtgctacggaaggtgccttaagtaac
agacatatacgaacccagattatatcagttctgattggtataggtgctattattgcaatc
atgctcatagactataacagtctttcaagaatgtatattcctatttatattttgtcgaat
gcactactcctggcagtacttgttatggggacaggacaagaacagtggggtgccaataga
tggattcgaatcgctggatttcaatttcagccagcggattttgccaaaataggcatcatc
atttgcttagcaaaaatgatagatgataataaggaatcaatccacaaaattcctacccta
atgaaaattattgcatttgcaggtcttcccatgctattgatcatgagacagcctgaccta
ggaaccaccatggcctttgcatccttcacctttgggatgctttttatagccggattgaga
tataagcatatattaataacaggaattatgggagtggtaagtttaccatttatgtggttt
gtggtcttaaaaggttatcagcagcaaagaatattaacctttttgaatcctgagttagat
ccccaaggcgcaggatatcatattattcaatcaaagattacagttggtgctggaaggacc
ctagggatgcgtttagaaaactttctggggattaatccaccgagcacaactttttttcac
cattttggctttttaccagaaaaacatacagacttcattttttcagtcattgcccaagag
cttggtttcgttgggtcgattgtcctgttgatattgtatgcgattcttttgatcaagtgt
atgaatgtagctagagaagcaaaggatgattttggaaaatatatcgtaacagggattaca
tttatgttggcattccatattattgcaaacattgcaatgaccattggattgatgcctgta
actggaaagcccttaccatttgtcagctatggcggtacatttatgctctcaaatatgatt
gcgctaggattagttttaaatgttaatatgcgacgtgataagattaatttctaa

DBGET integrated database retrieval system