KEGG   Alkaliphilus metalliredigens: Amet_1677Help
Entry
Amet_1677         CDS       T00551                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
amt  Alkaliphilus metalliredigens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Amet_1677
Enzymes [BR:amt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Amet_1677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1778721..1780196
Genome map
AA seq 491 aa AA seqDB search
MERSSGILMHISSLPSPYGIGSFGKEAYEFIDFLSIAGQKYWQILPIGSTGYGDSPYQSF
STFAGNPFFIDLQLLKEEDLLEARDFDNIDFGDNPTKVDYSKIFENKLPVLRKAFENGKI
RYGDEVEAFKKENVLWVEDYGLYMALKFHFNSKSWQEWEQDIKLREQEAIHYYKERLKDE
IDYWIFLQFLFFIQWNRLKNYANDKGIKIIGDIPIYVAEDSVDAWVNSEIFLFDEYNRPI
HVAGCPPDGFSETGQLWGNPLYRWDVLEERGFDWWVERISGSMRLYDVIRVDHFRGLESY
WAVPYGEQTAEGGNWLKGPGIKLFHAIEAQLGHVEIIAEDLGFLTPDVIALREQTKYPGM
KVLQFAFNIWEESDYLPHNYDKDCVVYTGTHDNDTVMGWLQNGPRDDVAFAKRYLHLNEE
EGVHWGFIRGAWSSVGDLAIAQLQDFLGLGSEARMNTPSTLEGNWHWRVKKEALTRELAE
KIGGLTKLYGR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaagcagtgggattttgatgcatatttcatccctacctagtccctatggaata
ggaagttttggaaaggaagcctatgaatttatagactttttatctatagcaggacaaaaa
tattggcagatactccctattggatctacgggttacggagattccccctatcagtccttt
tctacctttgccggtaatcctttttttatcgatttacagttattgaaggaggaggatctg
ctggaagctagggattttgataatatagattttggagataatcccacgaaagtagactac
agcaagatatttgaaaacaaattaccggttttaagaaaagcatttgaaaatgggaaaata
agatatggtgacgaggttgaggcctttaaaaaagaaaatgtattgtgggtagaggattat
ggtctttatatggccttgaagtttcactttaactctaaatcatggcaggaatgggaacag
gacattaagcttagggaacaagaagcaattcattattataaagaacgattaaaggacgaa
attgactattggattttcctacagtttcttttttttatacaatggaatcggttaaaaaat
tatgccaatgataagggaattaaaattattggggatattcccatctatgtggcagaggat
agtgttgatgcatgggtcaacagtgaaatatttttatttgacgaatacaatagaccgatt
cacgttgctgggtgtccaccggatgggttttctgaaactggccaattatggggaaatcct
ctctatcgctgggatgttttggaggagaggggctttgattggtgggtggaaagaatctca
ggaagtatgagattatatgatgtcattagagtagaccattttagagggttagaatcctat
tgggcggtgccctatggagaacaaactgctgaaggtggtaactggttaaaggggcctgga
attaagctttttcatgccattgaagcgcaattagggcatgttgaaattatcgcagaggat
ttgggttttctgacaccagatgtcattgccttgagagaacagacaaaataccctggcatg
aaggtattgcaatttgcctttaatatatgggaagagagtgactatctgccccataactat
gataaagactgtgtagtttatacaggaacccatgacaatgataccgtaatgggatggtta
caaaatggacctagagacgatgtggcatttgccaaaaggtatttacatcttaatgaagag
gaaggtgttcattggggattcataaggggcgcctggagctctgtaggggatttagctatt
gcccagttacaggatttcttagggttagggagtgaggctaggatgaacacgccttcaacc
ctagagggcaattggcattggcgagtaaaaaaagaagcattaaccagggagttagctgaa
aaaataggtggactcacaaagttgtatgggaggtag

DBGET integrated database retrieval system