KEGG   Alkaliphilus metalliredigens: Amet_2163Help
Entry
Amet_2163         CDS       T00551                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
amt  Alkaliphilus metalliredigens
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:amt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2238029..2238514
Genome map
AA seq 161 aa AA seqDB search
MAKVYLGLGSNMGDKKNYIDEAIQMLKQHECFTVTKISSYYETDPVGYEDQDVFLNVVVE
GDTTLTPYYLLGYCNGIEEALNRKRLIRWGPRTIDVDILLYENFTSRKKKLTVPHPRMTE
RAFVIIPLHEIASNITIGGNAIKNIIKILEDQGIRKVYYDG
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggtatatctagggctgggaagtaatatgggagataaaaaaaattacatagat
gaggctattcaaatgttgaagcagcatgaatgcttcactgtcacaaagatatcctcctat
tatgaaacagatccagtaggctatgaggatcaggatgttttcttaaatgtagtagtggaa
ggagataccaccctgaccccctattatttactcggatactgtaatgggatcgaggaagca
ttaaatagaaaaagattgattcgttggggccccagaacaatcgacgtagatatactactt
tatgaaaactttacctccaggaagaaaaaactaactgtcccccatcctcgaatgacggaa
agggcctttgtcataattcccttacatgagattgcatcaaatattacaataggtggaaat
gcaataaaaaatatcattaaaatccttgaagaccaagggattaggaaggtttactatgat
ggataa

DBGET integrated database retrieval system