KEGG   Alkaliphilus metalliredigens: Amet_2621Help
Entry
Amet_2621         CDS       T00551                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
amt  Alkaliphilus metalliredigens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2638590..2639612)
Genome map
AA seq 340 aa AA seqDB search
MLLKKLTEALGVSGNEGEVRELIKGELDDSVDQLRVDRMGNLFATKNTVNSDYRIIVTAH
MDEIGLMVKGIEESGLLRFAPIGGIDPRILVSKIVLIGDNKLIGIIGAKAIHMQKPSERK
KALSIDDLYIDIGVSSKEEAEKLLSIGDYIAFQSDYVEFANNRVKSKALDNRVGCAILIE
LLKMDLNVNITGIFTVQEEIGLRGSAVAANQIKGDLAIVLEGTTCSDVKGIEPHFQATNL
DGGPAISIMDRTSIYNRPLVDSLIETAKENNIPWQYRRSSFGGNDAGSFHLAQEGTPCVS
LAVPCRYIHSPASVLSLDDYRHTLNLTVKFIEKISKGGVI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgctattaaaaaaattaactgaagccttaggagtctctggaaatgaaggagaagtgcga
gagctaataaaaggtgaactagatgattctgtagatcagctacgagttgatcgcatgggt
aatctatttgcaacaaaaaacacagttaactcagattatcgaatcatcgtcacagcccat
atggatgaaattggcctgatggtaaagggtattgaagagagtgggctcctgcgatttgca
ccaattggtggtattgatccaagaatactggtttctaaaattgtgctcattggtgacaac
aagctcattggcattattggagccaaagccatccacatgcaaaaaccatctgagcgaaaa
aaagcgctatcaattgacgatttgtacatagatattggtgtgagttctaaagaagaagcg
gaaaaattgctttctattggagactacattgctttccaaagtgattatgttgagtttgct
aacaatagagtgaaatccaaagccttagacaaccgtgtaggctgtgcgatactaattgag
ttgcttaaaatggatttaaatgttaatataactggaatctttacagtgcaagaagaaatt
ggattgagaggatccgcagttgcagccaatcaaataaaaggagatctggcaattgttctt
gagggaactacatgttcagatgtaaaagggattgaaccacattttcaagcgacgaattta
gatggtggtcctgccatttcaatcatggatcgtacttctatttataatcgccctctagta
gactcgttaattgaaaccgcaaaggaaaacaatattccatggcaatatagacgatcaagc
ttcggtggtaatgatgctggcagctttcaccttgcccaagaaggaactccctgcgtttct
ttagctgttccttgtcgttatattcattcaccggcctctgtattgagtctagatgattat
agacacacattaaatttaactgtaaagtttattgaaaaaataagtaaaggtggcgttata
taa

DBGET integrated database retrieval system