KEGG   Alkaliphilus metalliredigens: Amet_2622Help
Entry
Amet_2622         CDS       T00551                                 

Definition
(GenBank) peptidase M42 family protein
Organism
amt  Alkaliphilus metalliredigens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ABR48774
JGI: Amet2622
UniProt: A6TRF6
Position
complement(2639603..2640655)
Genome map
AA seq 350 aa AA seqDB search
MNLREVIIELSEASGVSGHEEKVSQVITSIFADYVDEIKKDALGNLIMIKKGRNSGGKKI
MLAAHMDEIGLMVKDIDDKGFISFTNIGGVDQRTLLCQEVLIHGSEETYGIIGAKPPHLT
DASERENALSIEDLVIDTGFSKQALEGKIQIGDVITVKRAVSTLQNGWLAGKALDDRAGV
AVLYQCLRLLQDSYHDIDVYCVATVQEEVGTRGATTSAYQINPDIGIAIDVGFGRTPELN
RFDTIEMGKGPAITMGPNINPLIFKHLKTVAQENYIDYQVEVAPGSTGTDAWPIQIARSG
VATGLLSIPLRYMHTSVETICLSDIEKTGKLLSQFIVSFNTQEVESLLCY
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacgcgaagtaatcattgaattatcggaagcttccggtgtatccggtcatgaa
gagaaagtttctcaagttattaccagtatatttgcagactatgttgatgaaatcaaaaaa
gatgccttaggaaatttaattatgattaaaaaaggcagaaatagtggcggaaaaaaaatt
atgctagcagctcatatggatgaaataggcttaatggtcaaagatatagatgataaaggc
tttatttcatttacaaacattggtggtgtcgatcagcggacgctcctatgtcaagaagta
ttgattcatggttctgaggaaacctacggtattattggcgcaaaaccacctcacctcaca
gatgcaagtgaaagagagaatgctttatcaattgaagacttggtgattgatactggtttt
tcaaagcaagccctagagggaaaaatccaaattggcgatgtcattactgttaaaagagcg
gtttctactttgcagaatggatggcttgcaggcaaggccttagatgaccgtgctggagtt
gctgtgttgtaccaatgtctccgattactacaagattcctatcatgacatagatgtttat
tgcgtggccactgtacaggaagaagtcggtacacggggtgctacgacctccgcttatcag
attaaccctgatattggtattgccattgatgtgggatttggaagaacaccagagttaaat
cgttttgatacaatcgaaatgggaaagggacctgccattaccatgggccccaacatcaac
ccattaatctttaaacatttaaagacagtggctcaagaaaattatattgattatcaagta
gaagtcgctccaggttcaacaggaacagatgcttggcctattcaaattgcacgttcaggt
gttgcaacaggtttattgtcaattccactacgttacatgcatacctctgtggagacaatt
tgtttatccgacatagaaaaaacaggaaagcttctatcacaattcattgtttcctttaat
actcaggaggtggagtcattattatgctattaa

DBGET integrated database retrieval system