KEGG   Alkaliphilus metalliredigens: Amet_2650Help
Entry
Amet_2650         CDS       T00551                                 

Definition
putative agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
amt  Alkaliphilus metalliredigens
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:amt00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2663800..2664648
Genome map
AA seq 282 aa AA seqDB search
MEMFNQYQFIGCTETLEEAKIVFFGAPYDGTSSFRPGSRFAASRIRIDSYGLETYSPYLE
KDLEQYLIHDAGDIELGFGNRDVALKEINEFVKEVVASNKKPLMIGGEHLVTLPAIQAVH
EKYQDLIVLHFDAHADLRAHYLGEKLSHATVMGRVWDFLGDERIYQFGIRSGTQEEFKWS
AEGHTFMNKFGYESLDEIIDQVKNKPVYVTIDLDVLDPSIFPGTGTPEPGGISFTDMMRI
IKKLSILNIVGADIVELAPDYDPTGVSTAVASKVIREMLLIL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgtttaatcaatatcaatttattggttgtactgagacattagaagaggctaag
atcgtcttctttggagccccttatgatggcacaagttcatttagacctggatcaaggttt
gctgctagtcggataagaatcgattcttatggcttagaaacctatagtccctacctagaa
aaagatttagagcagtatctaattcatgacgcaggtgatatagaactgggatttggtaat
cgcgatgttgctctcaaggagattaatgagtttgttaaagaggtagttgcatcaaataaa
aaaccattgatgattggtggagagcatttggtgacacttcctgcaatacaagcggttcat
gaaaagtatcaagatttaattgtactacacttcgatgcacatgcagatttaagagcacat
tacttaggtgaaaaattatctcatgctactgtaatgggaagggtgtgggactttttagga
gatgagagaatttatcagtttggaattcgttctggtacccaagaagagtttaaatggtct
gcagaaggacatactttcatgaataaatttggttatgagtccttggatgagattattgat
caagtgaaaaacaaacctgtttatgtaacaattgatttagatgtgctagacccctcaatt
tttccagggacagggacaccagagcctggaggtatttcttttactgatatgatgcgaatt
atcaaaaaactgtccattttgaatatcgtgggtgctgatattgttgagcttgcacctgac
tatgaccctactggggtatccactgctgttgcatcaaaggtcattagagaaatgctactt
atcttataa

DBGET integrated database retrieval system