KEGG   Alkaliphilus metalliredigens: Amet_3578Help
Entry
Amet_3578         CDS       T00551                                 

Definition
(GenBank) Triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
amt  Alkaliphilus metalliredigens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:amt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Amet_3578
   01230 Biosynthesis of amino acids
    Amet_3578
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amet_3578
   00051 Fructose and mannose metabolism
    Amet_3578
   00562 Inositol phosphate metabolism
    Amet_3578
Enzymes [BR:amt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Amet_3578
Exosome [BR:amt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Amet_3578
  Exosomal proteins of bladder cancer cells
   Amet_3578
  Exosomal proteins of melanoma cells
   Amet_3578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3669972..3670718)
Genome map
AA seq 248 aa AA seqDB search
MRKPIIAGNWKMNKTVAETLQFINEIRDQAETTDVEVVLCCPFTALSEAKKALGASKIKL
GAQNMHWEDNGAFTGEISAEMLKELGVDYILIGHSERRQYFNETDETVNKKIKKALEQKL
MPILCVGETLQEREAAQTFDVIKNQITIDLEGILPDSMKDIVIAYEPIWAIGTGKTASSQ
DANHVIAYIRQLIQEKYDDGISETVRIQYGGSVKPENATEIMNEEDIDGALVGGASLKAD
AFLGIVNF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagccaattattgcaggtaactggaaaatgaacaaaaccgtagctgaaacatta
cagtttatcaatgagatacgggatcaagcggagacaactgatgtggaagtggttttatgc
tgtccattcactgcattaagtgaagcgaaaaaagccttgggcgcttctaaaataaagctt
ggggcccaaaatatgcattgggaagacaatggcgcattcacaggagaaatctctgcagaa
atgcttaaggagcttggtgtggattacatcctcattggacattctgagagaagacaatac
tttaacgagaccgacgaaaccgtcaacaaaaagataaagaaggctttagaacaaaaatta
atgccaatattatgcgtgggggaaaccttacaagaaagagaagcagcccaaacatttgat
gtaatcaagaatcagataaccatagatttagaaggcattttaccagatagcatgaaggat
attgtcattgcatatgagcctatttgggcaattggaacaggcaagaccgcttcttcacag
gatgccaaccatgtcattgcctatattagacagctaatccaagaaaaatatgacgatgga
atttcagagacagttcgcattcagtacggtggtagtgtgaaaccagaaaatgccacggaa
atcatgaatgaagaagacattgacggtgccctagtaggcggtgctagcttaaaagcagat
gcatttttaggaattgtgaatttctag

DBGET integrated database retrieval system