KEGG   Alkaliphilus metalliredigens: Amet_3620Help
Entry
Amet_3620         CDS       T00551                                 

Definition
phosphoglycerate mutase
Orthology
K02226  
alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
amt  Alkaliphilus metalliredigens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:amt00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3718535..3719140)
Genome map
AA seq 201 aa AA seqDB search
MTRIYLIRHGETQDNYEKKLCGWIDGPLNQLGKIQAAGCGEALRNIKMHVIYTSPLKRAY
ETAEAIRGERQEEVIVVEELKELHFGDLEGWTMKAVQETHPDIYNGIRTDSVNFQFPNGE
SMKQMHERATKKIEELIEKHPNENIVIVAHSGVLRSVIAHLITGKIDHHWSFKVDHCSIS
IVEKVGDMYVLNKLNQDRHLV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgactcgaatttatttgatacggcacggggaaacccaggataactatgaaaaaaagctt
tgtggttggattgatgggcctttaaatcaattaggaaaaattcaagccgctggctgcgga
gaggcattgagaaacataaaaatgcatgtcatttataccagtcccctaaagcgtgcctat
gaaactgcagaggcaattagaggggaacgacaagaagaagtcattgttgtagaagagctt
aaagagctccactttggagatttggaaggatggaccatgaaggcagtacaagaaacacat
ccagatatttataatggaattagaactgattcagtaaattttcagtttcccaatggggaa
agcatgaagcaaatgcatgaacgagcaaccaagaagatagaagagctgattgagaaacat
cccaatgaaaatattgtgattgtggcacactccggtgtactccgaagtgtgattgcacat
ttgataacgggcaaaattgatcatcattggagttttaaagtagatcattgtagtatttca
atagttgagaaggttggagacatgtatgttttaaacaagctcaaccaggacagacatcta
gtgtaa

DBGET integrated database retrieval system