KEGG   Alkaliphilus metalliredigens: Amet_3824Help
Entry
Amet_3824         CDS       T00551                                 

Definition
acetaldehyde dehydrogenase
Orthology
K00132  
acetaldehyde dehydrogenase (acetylating) [EC:1.2.1.10]
Organism
amt  Alkaliphilus metalliredigens
Pathway
Benzoate degradation
Pyruvate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:amt00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:amt00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:amt00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3941058..3942584)
Genome map
AA seq 508 aa AA seqDB search
MEDFDRDLRSIQEARVLATKGKIASNQISEYSKEQIEKIICNMVKVAKENAVMLAEMAVD
ETGFGTVKDKTYKNHMASVMLYEEIKDMKTIGIIDEDQEKQVIDLAEPMGLLMGIIPSTN
PTSTAIFKSIISIKSRNGIVFSPHPASLKCTVKAIQLMNDAAVQAGAPENIISSITTPSV
EATNALMKHKNIALIIATGGPGMVKASYSAGKPALGVGAGNSPAYIEKSANIPKAISNII
ASKTFDHGTICASEQSIIVEESNSDEVIEELKKQGAYFMTEEETKRVCKIIFKDGHTMNA
NFVGKPPQVIGDAAGIVIPQGTKLLVGEQKGVGTGFPLSYEKLTTVIAFYKVKDWEEACN
LSIDLLQNGIGHTMCLHTEDREMVMKFAKKPASRILVNTGGAQGGTGASTGLFPSFTLGC
GTWGGSSTSENVSPMDLINIKRVAYGLSDCATLASRDRTFNYFDVEKNNLDIPKNCEESM
QNNDSTDIDNDKLVKMVYELVEAMKGAN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
ttggaagattttgatcgagatttacgctctatacaagaagcaagggtcttggcaacaaaa
gggaaaatcgcatctaatcaaatttcagagtatagtaaagagcaaatagaaaaaattatt
tgcaatatggttaaagtagcaaaagaaaatgccgtcatgcttgcagaaatggcagtagat
gagacgggttttggtacagttaaagacaaaacttataaaaatcatatggcttctgtaatg
ctatatgaggaaattaaagacatgaaaaccattggtataatcgatgaagatcaagaaaaa
caagtgattgatttagcagaacctatgggtttgctaatggggattattccatctactaac
ccaacttcaacagcaatttttaaatcgattatctccataaagtcccgaaatgggattgtg
ttttcacctcatcctgcatcattgaaatgtaccgtgaaagccatccaattaatgaatgat
gcagccgttcaagcgggagcgccagaaaatattatcagtagcattacgacacctagtgta
gaagctaccaatgcgttaatgaaacataagaatattgctttaattattgctacaggaggg
ccaggaatggtaaaagcctcttatagcgcagggaaaccagctttaggggttggggcaggg
aattcacctgcatacattgaaaaatcagcaaatataccgaaggccataagcaatattatt
gcaagtaaaacctttgatcatgggaccatttgtgcatctgaacaatcgattattgttgag
gaaagcaacagtgatgaagtgatagaagaacttaaaaaacaaggtgcatattttatgacg
gaggaggaaacaaagcgagtttgcaaaataatatttaaagatggacataccatgaatgca
aactttgttggaaaaccccctcaagtaattggcgatgcagcaggaattgttatccctcaa
gggacaaagttattagtaggagaacaaaaaggggtaggaacagggtttccactatcttac
gaaaagctaactacagtaattgctttttataaggtgaaagattgggaagaggcatgtaac
ttaagtattgatttactccaaaatgggataggacatacgatgtgtcttcatacggaggat
cgagaaatggttatgaagttcgctaaaaaaccagcatctcgtattcttgtaaatacaggt
ggagcacaaggcggtactggtgcaagtacagggttatttccatcatttacccttgggtgt
ggaacctggggagggagttcaacctctgaaaatgtttcacctatggatttaatcaatatt
aaacgcgtcgcttatggactatcggattgcgcaacgctagcatcacgagatagaactttt
aactattttgatgttgagaagaataatcttgatattcccaaaaattgtgaagaatcaatg
caaaacaacgattctacagacattgacaatgacaagcttgtgaaaatggtatatgagcta
gtggaagcaatgaaaggggctaattaa

DBGET integrated database retrieval system