KEGG   Akkermansia muciniphila: Amuc_0097Help
Entry
Amuc_0097         CDS       T00736                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
amu  Akkermansia muciniphila
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Amuc_0097
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amuc_0097
   00052 Galactose metabolism
    Amuc_0097
   00500 Starch and sucrose metabolism
    Amuc_0097
   00520 Amino sugar and nucleotide sugar metabolism
    Amuc_0097
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Amuc_0097
   00524 Butirosin and neomycin biosynthesis
    Amuc_0097
Enzymes [BR:amu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Amuc_0097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
123193..124152
Genome map
AA seq 319 aa AA seqDB search
MTASTIPSIGIDFGGTSIKMGVVKGAEVIAHAPSIATQEYGNPDQLIEAIAQFVNMLRLN
HPEVQAIGMGMPGFVNFYQGTVYTLTNVPGWNNVPVKDMLQAACGLPVYVENDANCMAYA
EWKLGAGKGKRHLVCLTLGTGVGSGLIVNGELLRGATCSAGELGQTSIDYRGRLGHYGNR
GSLEDYVGNREIAADARTLYASHGIDKAIVDCNPISLERAALAGDEVAEQVWRDLAVKLS
CALMNCCYLLNPEAIIIGGGVAKARTLLFQPLQEIMKTQLAAPLVEYLEILPAQFGTEAG
ILGAAHLALNTHFGETFRA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacagcttcaaccattccctccatcggcattgacttcggaggcacctccatcaagatg
ggggtcgtcaagggcgcggaagtaatcgcccacgctccttcaatagccacccaggaatac
ggcaatcccgatcaactgattgaagccatagcccagttcgtgaatatgctgcggctgaat
cacccggaagtgcaggccatcggcatgggaatgccggggttcgtcaatttttaccagggg
accgtttatacgcttaccaacgtgcccggttggaacaacgttccggtaaaggacatgctc
caggctgcctgcggactgcccgtatacgtggaaaacgacgccaactgcatggcttatgcg
gaatggaagctgggcgccggaaaaggaaaaaggcatctggtctgcctgaccctcggcacc
ggcgttggcagcggcctgatcgtgaacggagaacttctgcgcggggctacctgctccgcc
ggggagctggggcagacgagcatcgactaccgggggcgtctgggccattacggaaaccgc
ggctccctggaagattatgtaggcaaccgggaaatagctgcggatgcacgcacgctgtat
gccagccacggcattgacaaggccattgtggactgcaaccccatctctttggaacgggcc
gcattggctggtgatgaagtagccgagcaagtatggcgggacctggccgtaaaactctcc
tgcgccctgatgaattgctgctatctcctgaacccggaagccatcatcatcggcgggggc
gtggccaaggccagaaccctgcttttccagccccttcaggaaatcatgaaaacccagctc
gccgcccctctggtggaataccttgaaatccttcccgcccagttcggtacggaggcgggc
atcctgggggccgcccatctggctctcaacacccacttcggagaaacattccgggcctga

DBGET integrated database retrieval system