KEGG   Akkermansia muciniphila: Amuc_0211Help
Entry
Amuc_0211         CDS       T00736                                 

Definition
uracil-DNA glycosylase
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
amu  Akkermansia muciniphila
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:amu00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Amuc_0211
Enzymes [BR:amu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Amuc_0211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
261314..262045
Genome map
AA seq 243 aa AA seqDB search
MNDTAAAILKATAALRDGTEKLRFESPVHVTYNPLTYAWGPHEQYVRTYGNGEKGHLFLG
MNPGPFGMAQTGVPFGEVDAVVNWLHIRGEVGRPEHTHPKRPVEGFGCPRSEVSGRRLWG
LFAEAFGTAENFFRHNYVANYCPLIWMGATGANITPDKLPAEQRAAVDAVCMEHLLSLIT
ILNPHTLVGVGAYATQKLRDAASRLPGKSFTIGTLLHPSPASPIANKLWPERPIQQLKEL
GIL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacactgcagcagccattctgaaagccacggccgccctccgggacggcacggag
aagctccggttcgaatccccggtccatgttacctacaaccctctcacctatgcatggggg
ccgcatgaacagtatgtgcgcacctacggaaacggggaaaagggccatctgttcctgggc
atgaatcccggccccttcggcatggcccagacaggcgtccccttcggggaagtggacgcc
gtcgtcaactggctgcacattcgcggagaagtcgggcggccggaacatacccaccccaaa
cgtcccgtggagggtttcggctgccccaggtcggaagtcagcggccgccgcctctgggga
cttttcgcggaagctttcggaactgcggaaaacttcttccgtcacaattacgtggccaat
tactgtccgctgatctggatgggagccaccggagccaacattacgccggacaaactgccg
gcggaacagcgcgccgccgtggacgcagtatgcatggaacacctgctttccctcatcacc
atcctgaatccccacacgctggtgggtgtgggtgcctacgccacgcagaagctgcgggac
gccgcctcccggctccccggcaaaagcttcaccatcggcacgttgctccacccaagcccc
gccagccccatcgccaacaagctctggccggaacgccccatccagcagcttaaggaactg
ggcattttataa

DBGET integrated database retrieval system