KEGG   Akkermansia muciniphila: Amuc_0562Help
Entry
Amuc_0562         CDS       T00736                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
amu  Akkermansia muciniphila
Pathway
amu00010  Glycolysis / Gluconeogenesis
amu00051  Fructose and mannose metabolism
amu00562  Inositol phosphate metabolism
amu01100  Metabolic pathways
amu01110  Biosynthesis of secondary metabolites
amu01120  Microbial metabolism in diverse environments
amu01130  Biosynthesis of antibiotics
amu01200  Carbon metabolism
amu01230  Biosynthesis of amino acids
Module
amu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
amu_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amuc_0562
   00051 Fructose and mannose metabolism
    Amuc_0562
   00562 Inositol phosphate metabolism
    Amuc_0562
Enzymes [BR:amu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Amuc_0562
Exosome [BR:amu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Amuc_0562
  Exosomal proteins of bladder cancer cells
   Amuc_0562
  Exosomal proteins of melanoma cells
   Amuc_0562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ComFB
Motif
Other DBs
NCBI-ProteinID: ACD04399
JGI: Amuc0562
UniProt: B2UP29
Position
661692..662456
Genome map
AA seq 254 aa AA seqDB search
MSRKPIIAANWKMNIGPAEGTQFIESFKNLIKGKDVACDVVIIPPFTTIPSVQNALGGCS
CIAAGAQNVSQYDNGAYTGEISTSMLNELNLKYVVLGHSERRQYFGETDAIINSKIKKAI
AAGITPIFCIGETKDERLGGILEPVLEIQLKGGLKDLTPEEVSNLVIAYEPVWAIGTGLT
ATSKEAQEAHSFIRKVISDVFGADAAAKVRIQYGGSVKPENVEELMAQPDIDGALVGGAS
LKPESFAALVTSAK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcaaacccatcattgccgccaactggaagatgaacatcggccccgccgaaggc
acccagttcatcgaaagcttcaaaaacctcattaaggggaaagacgtcgcgtgtgacgtg
gtcatcatccctcccttcaccaccattccctccgtgcagaacgctctgggcggttgctcc
tgcatcgccgccggagcccagaacgtctcccagtacgacaacggagcttataccggtgaa
atctccaccagcatgctgaatgaactgaacctcaagtatgtggtgctcggccacagcgaa
cgccgccaatatttcggagaaacggatgccattatcaactccaaaatcaagaaggccatc
gccgcaggcatcacccccattttctgcatcggagaaacgaaggacgaacgcctggggggc
attttggaacccgtgctggaaatccagctcaagggcggcctcaaggatctcaccccggag
gaggtatccaacctggtcatcgcctatgaacccgtctgggccattggcaccggcctgacc
gcaacttccaaggaagcccaagaagcccattcctttatccgcaaggttatttccgacgtc
ttcggagcagacgccgccgccaaggtgcgcatccagtacggcggctccgtaaaaccggaa
aacgtggaggaactcatggcccagccggacattgacggggctctggttggcggcgcttcc
ctgaagccggaatccttcgctgctctggtaacttccgccaaataa

DBGET integrated database retrieval system