KEGG   Akkermansia muciniphila: Amuc_0562Help
Entry
Amuc_0562         CDS       T00736                                 

Definition
(RefSeq) Triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
amu  Akkermansia muciniphila
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Amuc_0562
   01230 Biosynthesis of amino acids
    Amuc_0562
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amuc_0562
   00051 Fructose and mannose metabolism
    Amuc_0562
   00562 Inositol phosphate metabolism
    Amuc_0562
Enzymes [BR:amu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Amuc_0562
Exosome [BR:amu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Amuc_0562
  Exosomal proteins of bladder cancer cells
   Amuc_0562
  Exosomal proteins of melanoma cells
   Amuc_0562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
661692..662456
Genome map
AA seq 254 aa AA seqDB search
MSRKPIIAANWKMNIGPAEGTQFIESFKNLIKGKDVACDVVIIPPFTTIPSVQNALGGCS
CIAAGAQNVSQYDNGAYTGEISTSMLNELNLKYVVLGHSERRQYFGETDAIINSKIKKAI
AAGITPIFCIGETKDERLGGILEPVLEIQLKGGLKDLTPEEVSNLVIAYEPVWAIGTGLT
ATSKEAQEAHSFIRKVISDVFGADAAAKVRIQYGGSVKPENVEELMAQPDIDGALVGGAS
LKPESFAALVTSAK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcaaacccatcattgccgccaactggaagatgaacatcggccccgccgaaggc
acccagttcatcgaaagcttcaaaaacctcattaaggggaaagacgtcgcgtgtgacgtg
gtcatcatccctcccttcaccaccattccctccgtgcagaacgctctgggcggttgctcc
tgcatcgccgccggagcccagaacgtctcccagtacgacaacggagcttataccggtgaa
atctccaccagcatgctgaatgaactgaacctcaagtatgtggtgctcggccacagcgaa
cgccgccaatatttcggagaaacggatgccattatcaactccaaaatcaagaaggccatc
gccgcaggcatcacccccattttctgcatcggagaaacgaaggacgaacgcctggggggc
attttggaacccgtgctggaaatccagctcaagggcggcctcaaggatctcaccccggag
gaggtatccaacctggtcatcgcctatgaacccgtctgggccattggcaccggcctgacc
gcaacttccaaggaagcccaagaagcccattcctttatccgcaaggttatttccgacgtc
ttcggagcagacgccgccgccaaggtgcgcatccagtacggcggctccgtaaaaccggaa
aacgtggaggaactcatggcccagccggacattgacggggctctggttggcggcgcttcc
ctgaagccggaatccttcgctgctctggtaacttccgccaaataa

DBGET integrated database retrieval system