KEGG   Akkermansia muciniphila: Amuc_0771Help
Entry
Amuc_0771         CDS       T00736                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
amu  Akkermansia muciniphila
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:amu00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:amu00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:amu00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(906706..908637)
Genome map
AA seq 643 aa AA seqDB search
MMKQYGFSWSAALMAVGVGALAWAGPEAVQNVQKPALSGGPPVVFGFGGEGNQEFMLNGK
PFQIRGAEMHPQRIPREYWRHRIRTAKAMGLNTIAFYVFWNDHEQPDGSFDFKTGNRDLE
GFLKLCQEEGMWVLFRPGPYACGEWDLGGLPHYLLKDPKAKLRTTEDAKFMKAQTRYLEA
VARVAEPFLAKNGGPILMTQLENEYGSYQRKDRKYMEWLKAFWSRKGFGPFYTSDGAGEH
FLKGVVLPGVAVGLDPGLNDGHWAVANKCNPGVPVFSSETYPGWLRHWGEGNWAPTPGVV
NHVRWFMDKGRSFSLFVFHGGTNFGFSAGANNGGPGKYQPDLTSYDYGSPVDEQGRMNEY
YAQMREIILKKLPPEAAVPEPPADIPAMEIPEFTPAVHAGLWENLPKPFRSKFPQPPYFE
QWNQNQGIAVYRTAVPSGPPETLEFTNVNDYAQVYLDGELVGTLDRRLGQKSVKLPERRK
PGTLEVLVEAMGHINFHISMESDRKGIYGPVKLGTRELKNWTVRALPLKADSIVRAPKGK
GPSQKREGAHFRAVVNIEEPQDTFLDMSRYVKGYVWVNGINVGRYWNVGPQLRLYVPAPF
LKKGENVIDILDLHEKEPKPVRGMKERNKEPGKINTKNLDNQW
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcaatatggtttcagttggtctgccgcactgatggccgtcggagtgggagca
ttggcatgggctggccctgaggctgtccagaatgtacagaaacccgctctttccggagga
ccccccgttgtgttcgggttcggcggggaagggaaccaggagttcatgctgaacgggaaa
cccttccagatccgcggcgcggagatgcatccccagcgcattccccgggaatactggagg
caccgcatcaggaccgccaaggctatggggctgaatactattgcattttatgtgttctgg
aatgaccatgagcagccggacggcagctttgactttaagacgggcaatcgggatctggaa
gggttcctcaagttatgccaggaggaaggaatgtgggttttattccgccccggcccctat
gcatgcggggaatgggatctgggtgggctgcctcattatttgctgaaggatcccaaggcc
aagttgagaactacggaagacgccaaattcatgaaggcgcagacgcgttatctggaggcc
gtggctcgtgtggcggagccttttttagccaaaaacgggggccccattctgatgacccag
cttgaaaacgaatacgggagctaccagcgtaaagaccgcaagtatatggaatggctgaag
gcgttctggagcaggaagggttttggccccttttacacctccgacggcgcgggagaacat
tttctgaaaggcgtggtgcttccaggcgtggccgtagggctggatccggggctgaacgac
ggccattgggcagtggctaataaatgcaatccgggagttcccgttttttcctcggaaaca
tatccgggttggctgcggcactggggggaggggaattgggctcccacccctggagtggtc
aaccacgtccgctggtttatggacaaggggcgttccttcagcttgttcgttttccacgga
ggcaccaatttcggattctcggccggagccaacaacggagggccgggaaaataccagccg
gacctgacgagttatgattacggttctcccgtggatgagcaggggcggatgaatgaatat
tatgcccagatgagggaaatcattttgaaaaagttgcctcccgaagccgctgtgccggaa
cctcccgcagacattccggccatggaaattccggagttcacgcccgcagtgcatgccggc
ctttgggagaacctgcccaagcctttccggtccaagttcccgcagcctccctattttgaa
caatggaaccagaaccagggtattgccgtttacagaacggccgttccgtcaggaccgcct
gaaacgctggaatttaccaatgtcaatgactatgcccaggtgtatctggatggagagctg
gtcggcacgctggatcggcggctggggcagaagagcgtgaaactgccggagcgcaggaag
ccggggacgctggaagttctggtagaggccatgggacatattaattttcatatcagcatg
gagagtgaccgcaaggggatttacggtcctgtgaagctgggaacgcgggagttaaagaac
tggacggtgagggcgcttcccctgaaagctgattccattgtgcgggctcccaaaggaaag
gggccttcccagaaacgggaaggggcgcatttccgggccgttgtaaatattgaagagcct
caggacacgtttctggatatgtcccgctatgtcaaggggtatgtatgggtgaacggaatc
aacgtggggcgctattggaatgtgggacctcagttaaggctgtatgtcccggccccattc
ctgaaaaaaggggagaatgtgattgatattctggacctgcacgaaaaggagcccaagcct
gtccgcggcatgaaggaacgcaacaaggaacccggaaagataaataccaaaaacctggac
aaccagtggtaa

DBGET integrated database retrieval system