KEGG   Akkermansia muciniphila: Amuc_0771Help
Entry
Amuc_0771         CDS       T00736                                 

Definition
(GenBank) Beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
amu  Akkermansia muciniphila
Pathway
amu00052  Galactose metabolism
amu00511  Other glycan degradation
amu00600  Sphingolipid metabolism
amu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Amuc_0771
  Lipid metabolism
   00600 Sphingolipid metabolism
    Amuc_0771
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Amuc_0771
Enzymes [BR:amu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Amuc_0771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5 Cellulase
Motif
Other DBs
NCBI-ProteinID: ACD04606
JGI: Amuc0771
UniProt: B2UQ71
Position
complement(906706..908637)
Genome map
AA seq 643 aa AA seqDB search
MMKQYGFSWSAALMAVGVGALAWAGPEAVQNVQKPALSGGPPVVFGFGGEGNQEFMLNGK
PFQIRGAEMHPQRIPREYWRHRIRTAKAMGLNTIAFYVFWNDHEQPDGSFDFKTGNRDLE
GFLKLCQEEGMWVLFRPGPYACGEWDLGGLPHYLLKDPKAKLRTTEDAKFMKAQTRYLEA
VARVAEPFLAKNGGPILMTQLENEYGSYQRKDRKYMEWLKAFWSRKGFGPFYTSDGAGEH
FLKGVVLPGVAVGLDPGLNDGHWAVANKCNPGVPVFSSETYPGWLRHWGEGNWAPTPGVV
NHVRWFMDKGRSFSLFVFHGGTNFGFSAGANNGGPGKYQPDLTSYDYGSPVDEQGRMNEY
YAQMREIILKKLPPEAAVPEPPADIPAMEIPEFTPAVHAGLWENLPKPFRSKFPQPPYFE
QWNQNQGIAVYRTAVPSGPPETLEFTNVNDYAQVYLDGELVGTLDRRLGQKSVKLPERRK
PGTLEVLVEAMGHINFHISMESDRKGIYGPVKLGTRELKNWTVRALPLKADSIVRAPKGK
GPSQKREGAHFRAVVNIEEPQDTFLDMSRYVKGYVWVNGINVGRYWNVGPQLRLYVPAPF
LKKGENVIDILDLHEKEPKPVRGMKERNKEPGKINTKNLDNQW
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcaatatggtttcagttggtctgccgcactgatggccgtcggagtgggagca
ttggcatgggctggccctgaggctgtccagaatgtacagaaacccgctctttccggagga
ccccccgttgtgttcgggttcggcggggaagggaaccaggagttcatgctgaacgggaaa
cccttccagatccgcggcgcggagatgcatccccagcgcattccccgggaatactggagg
caccgcatcaggaccgccaaggctatggggctgaatactattgcattttatgtgttctgg
aatgaccatgagcagccggacggcagctttgactttaagacgggcaatcgggatctggaa
gggttcctcaagttatgccaggaggaaggaatgtgggttttattccgccccggcccctat
gcatgcggggaatgggatctgggtgggctgcctcattatttgctgaaggatcccaaggcc
aagttgagaactacggaagacgccaaattcatgaaggcgcagacgcgttatctggaggcc
gtggctcgtgtggcggagccttttttagccaaaaacgggggccccattctgatgacccag
cttgaaaacgaatacgggagctaccagcgtaaagaccgcaagtatatggaatggctgaag
gcgttctggagcaggaagggttttggccccttttacacctccgacggcgcgggagaacat
tttctgaaaggcgtggtgcttccaggcgtggccgtagggctggatccggggctgaacgac
ggccattgggcagtggctaataaatgcaatccgggagttcccgttttttcctcggaaaca
tatccgggttggctgcggcactggggggaggggaattgggctcccacccctggagtggtc
aaccacgtccgctggtttatggacaaggggcgttccttcagcttgttcgttttccacgga
ggcaccaatttcggattctcggccggagccaacaacggagggccgggaaaataccagccg
gacctgacgagttatgattacggttctcccgtggatgagcaggggcggatgaatgaatat
tatgcccagatgagggaaatcattttgaaaaagttgcctcccgaagccgctgtgccggaa
cctcccgcagacattccggccatggaaattccggagttcacgcccgcagtgcatgccggc
ctttgggagaacctgcccaagcctttccggtccaagttcccgcagcctccctattttgaa
caatggaaccagaaccagggtattgccgtttacagaacggccgttccgtcaggaccgcct
gaaacgctggaatttaccaatgtcaatgactatgcccaggtgtatctggatggagagctg
gtcggcacgctggatcggcggctggggcagaagagcgtgaaactgccggagcgcaggaag
ccggggacgctggaagttctggtagaggccatgggacatattaattttcatatcagcatg
gagagtgaccgcaaggggatttacggtcctgtgaagctgggaacgcgggagttaaagaac
tggacggtgagggcgcttcccctgaaagctgattccattgtgcgggctcccaaaggaaag
gggccttcccagaaacgggaaggggcgcatttccgggccgttgtaaatattgaagagcct
caggacacgtttctggatatgtcccgctatgtcaaggggtatgtatgggtgaacggaatc
aacgtggggcgctattggaatgtgggacctcagttaaggctgtatgtcccggccccattc
ctgaaaaaaggggagaatgtgattgatattctggacctgcacgaaaaggagcccaagcct
gtccgcggcatgaaggaacgcaacaaggaacccggaaagataaataccaaaaacctggac
aaccagtggtaa

DBGET integrated database retrieval system