KEGG   Akkermansia muciniphila: Amuc_0824Help
Entry
Amuc_0824         CDS       T00736                                 

Definition
glycoside hydrolase family 2
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
amu  Akkermansia muciniphila
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Amuc_0824
  Lipid metabolism
   00600 Sphingolipid metabolism
    Amuc_0824
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Amuc_0824
Enzymes [BR:amu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Amuc_0824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
969353..973147
Genome map
AA seq 1264 aa AA seqDB search
MRTTRSWLLSCTALAVSSAMCGLGAPGDSAPAPAPTGLEWEQEQNLHLNKEAPTAFFASF
SDLQSALKVLPENSKWRRSLNGQWKFHWAKDPQSRPADFYKPDYDVKDWKEIKVPSSWQT
QGYGTPIYSNQPYPFERSWPYVMKEPSNKNYTSYKERNPVGSYRRTFEVPADWDGREVYM
QFDGVDSFFYLWINGQYVGFSKDSRNPARFDISPYLKKGENVVAAEVYRHSDGAYLECQD
MFRLSGIFRNVSIFALPKVHIRDFFAQANPVDQRDWALNIDHAKPGTVDGDWRLQVDVDV
RNLFPATEKLDGCTVSMALYDAAGKLVEPVKPKDAPYDGVLEKPLRITGMKDFKTSLLGI
YSKPRLWSAEDPNLYTLVLTLKRDGKTEEMVSSRVGFRNVVIKDSVFLVNGQPVKVKGVN
RHESHPETGHYVTPEQMEEEVRMMKRANINHVRCSHYPADPYFYYLCDKYGIYVQDEANI
ESHGYYYGKESLSHPIEWMPAHVDRIMAMVERNKNHPCVIMWSLGNEAGPGQNFRSAEKM
VKARDMSRPTHYERNNDIVDLGSNQYPSVDWTRSMAGNKDFPKPYYISEYAHNMMNAMGN
LADYWEAIESSDRIMGGAIWDWVDQGLYKTLPNGEKMLCYGGDFNDHPNSGQFVFNGTIL
SDRTPEPGYFEVKHVYQNISTSLTDDGRISIFNKNFFTDLSSYDITWTLTENGNAVAEGR
LDTPPAGPREKIVVPIPDIPQLKNRKPGVEYALRISYKLKKDRGWAKKGYELAFDQLQLP
VQGDLPVFKAPAGKVSLSTDKHTVSGKDFSVQFDASTGELAQFTVNGKPLFKTPMAVNAL
RAASSNEPGVMAKSMANGLRELKHELLSYEAIDNGNSVTVKQSIKVSGKQAENISGYGDT
KTTITARKQPLNDTNTHFINNLEWTIYADGTVVCQSVLLPRGNPLELLRLGYELQLPANM
DNVAYYGRGPEENYADRKSGMPLGVYKTTAWDSFFPYGRPQDCGNHEDTRWVAVTDDKGN
GLLFGSVGAPFAFSALPYTTTDLILANHPVELPKTTDKTVLVLSSATRGLGGASCGPGPM
GRDIIKANKPYPMSFFMRPITAKSYKGEIRVPAARLDMTMLTRTDKYTVKSVTSQEQGEA
DAEFAIDGDPGTFWHSEYNKTVTKHPHVLAVDLGKEREFSGITYLPRQDGSSNGRVKDYS
VDVSTDGEKWQPAAKGSFPDSADLQEVKFQAPVKARYFRFSALSEAQGRDYAAVAELDII
PVKK
NT seq 3795 nt NT seq  +upstreamnt  +downstreamnt
atgagaacgaccagatcctggcttttatcctgtaccgcgctggcggtaagttccgccatg
tgcggcctgggagcaccgggcgattccgcccccgcgccagcccccacagggctggaatgg
gaacaggaacaaaacctgcatttgaataaggaagctccaaccgcctttttcgcgtctttc
agcgatttgcagtccgccttgaaagtgctgcctgaaaacagtaaatggcgcaggtccctg
aacggtcagtggaagttccactgggcgaaggatccccagagccgcccggccgatttttac
aagccggattacgacgtaaaggactggaaggagattaaggtgccttcctcctggcagact
cagggttacggcacccccatttattccaatcagccgtatccctttgaacgctcctggcct
tatgtaatgaaggagccttccaacaagaattatacgtcctacaaggaacggaaccccgta
ggttcctaccgccgcacttttgaagtacctgcggactgggacggcagggaagtgtacatg
cagtttgacggagtggattccttcttctacctctggatcaacgggcagtatgtaggtttt
tccaaagattcccggaatccggcccgttttgacatcagcccctaccttaagaagggggag
aatgtggtggccgcagaggtgtaccgccattccgacggagcatatctggaatgccaggac
atgttccgcctgtccggcattttccgcaatgtttccatctttgcgctgccgaaagttcac
atccgcgactttttcgcacaggccaatccggtggaccagagggattgggctttgaatatt
gaccatgccaaaccggggaccgtggacggcgattggcgccttcaggtggatgtggatgtt
cgcaatctgtttccggcaacggaaaagctggacggctgcacggtttccatggccctgtat
gacgctgccggaaaactggtagaacctgtcaagcccaaggatgcgccatatgacggcgtg
ttggaaaagcccttgcgcattaccggcatgaaggattttaaaacttccctgctgggcatt
tattccaaacccagactatggtctgcggaggatcccaacctgtacaccctggtactgacg
ctgaagcgtgacgggaagacggaagaaatggtttcctcccgcgtgggtttccgcaatgtg
gtgattaaggacagcgtgttcctggtaaacggccagccggtgaaggtaaagggcgtgaac
cgccatgaaagccatccggaaacagggcattacgtgactccggagcagatggaggaagaa
gtgcggatgatgaaacgcgccaatatcaaccacgtgcgctgttcccattatcccgcggat
ccttatttttattacctctgtgacaagtacggcatttacgtgcaggatgaggccaacatc
gagtcccacggctattactatggcaaggagtccctttcccatcccattgagtggatgccg
gcccacgtggaccgcatcatggcgatggtggagcgcaacaagaaccatccctgcgtgatt
atgtggtccctggggaatgaagccggccccggccagaatttccgcagtgcggaaaagatg
gtgaaggccagggatatgtcccgccccacccactacgaacgcaataatgacattgtggac
ttggggtccaaccagtatccgtccgtggactggacgcgttccatggcgggcaacaaggat
ttccccaagccctactatatttccgagtacgcacacaacatgatgaatgccatgggcaac
ctggcggattactgggaggccatcgagtcttccgaccgcattatgggcggcgccatctgg
gactgggtggaccagggcttgtacaagaccctgccgaatggagaaaagatgctctgctat
ggcggcgatttcaacgaccatcccaatagcggccagtttgtgttcaacggcaccatcctg
tcggatcgtacgccggaaccgggttattttgaagtcaagcacgtctatcagaatatttcc
acatctttgacggacgacggcaggatttccattttcaacaagaatttctttacggacctt
tcttcatacgacattacctggaccctcacggaaaacggcaatgcagtggctgaaggcagg
ttggacacgcctccggccggtcccagagaaaagattgtggttcccattccggacattccc
cagttgaaaaaccggaaaccgggggtggagtatgccttgcgcataagttacaagctgaag
aaggacagggggtgggccaagaagggatatgaattggcctttgaccagctccagcttccc
gtgcagggagatctgcctgtgttcaaggctcctgcgggcaaagtcagcctcagcacggac
aagcataccgtttccggcaaggatttttccgtgcagtttgacgcgtccaccggggaactg
gcccagttcacggtaaacggcaagcctctgtttaaaacgcccatggcggtgaacgccctg
cgcgccgcctccagcaatgagccgggcgtcatggccaagagcatggctaacggcctccgt
gaactgaagcatgaactgctcagttacgaagccattgataacggcaatagcgtcaccgtc
aagcaatccatcaaggtaagcggcaaacaggctgaaaacatcagcggctacggcgatacc
aagaccaccatcacggccaggaagcaacccctgaacgatacgaacacccatttcatcaat
aatttggaatggaccatctatgcggatggaactgtcgtctgccagtccgtactgcttccg
cgcggcaatcccctggaactgctgcgcctgggatacgaactccagttgccggcgaatatg
gacaacgtagcctattacgggcgcgggccggaagaaaactatgcggaccgcaagagcggc
atgcctctgggcgtgtataaaacgacagcctgggattctttcttcccgtacggcagaccg
caggattgcggcaaccatgaggatacccgctgggtggccgttacggacgacaaggggaac
ggcctgcttttcggttccgtgggcgcaccgttcgctttctccgcccttccgtataccacc
acggatttgatcctggcaaaccaccccgtggaactgccgaagacgacggataagaccgtt
ctggttctctcttccgccacgcgcggcctggggggtgcttcctgcggtcccggccctatg
ggcagggacatcatcaaggccaacaagccctacccgatgtccttctttatgcggcccatt
accgccaagtcctacaagggggaaatccgcgtgcctgcggcccggctggatatgaccatg
ctgacccgcacggacaagtatacggtcaagagtgtaaccagccaggagcagggcgaagcg
gacgccgaattcgccattgacggtgatcccggcaccttctggcactctgaatacaataaa
accgtgaccaaacatccgcatgtactggccgtggacctgggtaaggagcgggaattctcc
ggaatcacttatcttccacgtcaggatggcagcagcaatggccgcgtgaaagattattcc
gtggacgtgagcacggacggagagaaatggcagcctgccgccaagggctccttcccggac
agtgctgacctgcaggaagtgaaattccaagctcccgtcaaggcgcgttatttccgcttc
tccgcccttagtgaggcgcaggggcgggattacgccgccgtagcggaactggatatcatt
cccgttaagaaataa

DBGET integrated database retrieval system