KEGG   Akkermansia muciniphila: Amuc_0867Help
Entry
Amuc_0867         CDS       T00736                                 

Definition
(GenBank) peptidase M42 family protein
Organism
amu  Akkermansia muciniphila
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1035676..1036824)
Genome map
AA seq 382 aa AA seqDB search
MNLELLRQVCVTPGAPGFEDKIRDFIIQEVAPLVDAVRVDNMGSVIAIVEGKNTEKTMMA
AAHMDEIGFMVRHIDDKGFIKFLPLGGFDAKTLTAQRVIVHGKKDLIGVMGVKPIHVMSP
AERTKLPEVTDFFIDLGMSKEEVEKYVSVGDSVTRERDLVEMGDCVNVKSLDNRAGCYVL
IEALRAIKASRKKPSCNFVAAFTVQEEVGLRGAQAGTLDIQPDFSIALDVTIACDIPGTP
AHDQVSHLGAGAAIKLYDGSVIADRRMVKFMKAMADANKIKWQTEMLPAGGTDAGAMQKF
VPGGSIAGAISVPTRNVHQVIEMAHKDDLDASVALLTACAMNVDKWDWSWNSVNECPAEK
PAKAAKTAAKPAKAAAKKKKAK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaatttggaactgcttcgtcaggtttgcgtgactccgggcgctccggggtttgaagac
aaaatccgcgatttcatcatccaggaagtggccccgctggtggacgccgtgcgcgtggac
aacatgggcagcgtgattgccatcgtggaaggcaaaaacacggaaaaaaccatgatggcc
gccgcccacatggatgaaatcgggttcatggtccgtcacatcgacgacaaggggttcatc
aaattcctgccactgggcggctttgacgccaagacgctgacggcccagcgcgtcatcgtc
cacggtaaaaaagacctcatcggcgtcatgggcgtgaaacccatccacgtcatgtccccg
gcggaacgtaccaagctgccggaagtgaccgacttcttcattgacctgggcatgagcaag
gaggaagtggaaaaatacgtttccgtaggcgactccgttacccgtgaacgggatttggtg
gaaatgggggattgcgtgaacgtcaaatctctggacaaccgcgccggatgctacgtgctg
attgaagccctccgcgccatcaaggcttccaggaagaaaccctcctgcaacttcgtggcc
gcctttaccgttcaggaggaagtgggcctgaggggcgcgcaggccggcacgctggacatc
caaccggatttctccattgccctggatgtcaccatcgcctgtgacattcccggaactccg
gcgcacgaccaggtttcccacctgggcgcaggcgccgccatcaagctgtatgacggttcc
gtcattgcagaccgccgcatggtcaagttcatgaaggccatggcagacgccaacaaaatt
aaatggcagacggaaatgctgccggcgggaggcacggatgccggagccatgcagaaattc
gttccgggcggttccattgccggggccatttccgttcccacccgcaatgtgcaccaggtt
attgaaatggctcacaaagacgacctggacgcttccgtagcgcttctgaccgcctgcgcc
atgaacgtggacaaatgggactggtcctggaactccgtcaacgaatgcccggcggaaaaa
cccgccaaggccgcaaaaacggcagccaagcccgccaaagccgctgccaagaagaaaaag
gccaaataa

DBGET integrated database retrieval system