KEGG   Akkermansia muciniphila: Amuc_0867Help
Entry
Amuc_0867         CDS       T00736                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
amu  Akkermansia muciniphila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Amuc_0867
Enzymes [BR:amu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Amuc_0867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1035676..1036824)
Genome map
AA seq 382 aa AA seqDB search
MNLELLRQVCVTPGAPGFEDKIRDFIIQEVAPLVDAVRVDNMGSVIAIVEGKNTEKTMMA
AAHMDEIGFMVRHIDDKGFIKFLPLGGFDAKTLTAQRVIVHGKKDLIGVMGVKPIHVMSP
AERTKLPEVTDFFIDLGMSKEEVEKYVSVGDSVTRERDLVEMGDCVNVKSLDNRAGCYVL
IEALRAIKASRKKPSCNFVAAFTVQEEVGLRGAQAGTLDIQPDFSIALDVTIACDIPGTP
AHDQVSHLGAGAAIKLYDGSVIADRRMVKFMKAMADANKIKWQTEMLPAGGTDAGAMQKF
VPGGSIAGAISVPTRNVHQVIEMAHKDDLDASVALLTACAMNVDKWDWSWNSVNECPAEK
PAKAAKTAAKPAKAAAKKKKAK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaatttggaactgcttcgtcaggtttgcgtgactccgggcgctccggggtttgaagac
aaaatccgcgatttcatcatccaggaagtggccccgctggtggacgccgtgcgcgtggac
aacatgggcagcgtgattgccatcgtggaaggcaaaaacacggaaaaaaccatgatggcc
gccgcccacatggatgaaatcgggttcatggtccgtcacatcgacgacaaggggttcatc
aaattcctgccactgggcggctttgacgccaagacgctgacggcccagcgcgtcatcgtc
cacggtaaaaaagacctcatcggcgtcatgggcgtgaaacccatccacgtcatgtccccg
gcggaacgtaccaagctgccggaagtgaccgacttcttcattgacctgggcatgagcaag
gaggaagtggaaaaatacgtttccgtaggcgactccgttacccgtgaacgggatttggtg
gaaatgggggattgcgtgaacgtcaaatctctggacaaccgcgccggatgctacgtgctg
attgaagccctccgcgccatcaaggcttccaggaagaaaccctcctgcaacttcgtggcc
gcctttaccgttcaggaggaagtgggcctgaggggcgcgcaggccggcacgctggacatc
caaccggatttctccattgccctggatgtcaccatcgcctgtgacattcccggaactccg
gcgcacgaccaggtttcccacctgggcgcaggcgccgccatcaagctgtatgacggttcc
gtcattgcagaccgccgcatggtcaagttcatgaaggccatggcagacgccaacaaaatt
aaatggcagacggaaatgctgccggcgggaggcacggatgccggagccatgcagaaattc
gttccgggcggttccattgccggggccatttccgttcccacccgcaatgtgcaccaggtt
attgaaatggctcacaaagacgacctggacgcttccgtagcgcttctgaccgcctgcgcc
atgaacgtggacaaatgggactggtcctggaactccgtcaacgaatgcccggcggaaaaa
cccgccaaggccgcaaaaacggcagccaagcccgccaaagccgctgccaagaagaaaaag
gccaaataa

DBGET integrated database retrieval system