KEGG   Akkermansia muciniphila: Amuc_0885Help
Entry
Amuc_0885         CDS       T00736                                 

Definition
catalytic domain of components of various dehydrogenase complexes
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
amu  Akkermansia muciniphila
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Amuc_0885
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amuc_0885
   00020 Citrate cycle (TCA cycle)
    Amuc_0885
   00620 Pyruvate metabolism
    Amuc_0885
Enzymes [BR:amu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Amuc_0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1053894..1055168)
Genome map
AA seq 424 aa AA seqDB search
MPKVPILMPQLGDSIAEATVLRLLAAQGDTVEADQEIFEVETNKATMGVTTMCGGILSDV
FIKEGESVVVGACMAMIEATEEEIERSGATPAGDSTQPSLPASPESVPQAAPSAPPREEK
PAGVHFGVTGESYQENGTDLKVQPSVRGLPVPAGMKGAHYMSPRMKARMDELGMSASDIA
FISGSGAGGRVTIDDLEEFLEYVSQWPHRKASSMRLAVADAMRRSWTRPLASAGRPVFMD
PLIKHRQNSPLRPGITLYFARALALSLAESPECAGYLVGENILSPKTIDIGIAAQVADGV
MVPVLRRVNERTMEELLEDYNRLIAQARRRRLAPEDSTGGIATVTNFGGFGLTFAAPMPM
PSESIILGVGAVTKTPVWSDEVEAFIPISKANIVATGDHRVVDGADIGRLLKRVAELLQR
PEYL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaagtacccattctgatgccccagctcggggattccattgcggaagccactgtg
ctgcgcctgctggcggcccagggcgataccgtagaagccgaccaggaaatctttgaggta
gaaaccaacaaggccaccatgggagtcaccaccatgtgcggcggcatcctgagcgatgtg
ttcatcaaggaaggggaatccgtcgtggtcggcgcctgcatggccatgattgaggccacg
gaagaggaaattgagcgttccggagcgactccggccggagattccacccagccgtccctt
ccagccagtccggaatccgttccccaggccgcgccctccgcccctccccgggaggaaaaa
cccgcaggcgtccacttcggggtgacgggggaatcctatcaggaaaacggaacggacctg
aaagtccagcccagcgtgcgcggcctccccgtacccgccggcatgaagggcgcgcactac
atgtccccccggatgaaggcgcgcatggatgaattgggcatgagcgcctccgacatcgct
ttcatctccggttccggggcgggcggacgcgtcaccattgacgacctggaagaattcctg
gaatatgttagccaatggccgcaccgcaaggcctcatccatgcggctggccgtggcggac
gccatgcgccgcagctggacgcgcccgctggcctccgccgggcgtcccgtattcatggac
cccctcatcaaacacaggcaaaattccccgctgcggcccggcatcaccctgtactttgcc
cgcgccctggccctgtccctggcggaaagcccggaatgcgccggctacctggtgggggaa
aacattctttctcccaaaacaatcgacatcggcatcgccgcccaggtggcggacggcgtc
atggttcccgtgctgcgccgcgtgaacgaacggacgatggaagaactgctggaagactat
aacaggctgattgcccaggcgcgccgccgcaggctggctccggaagacagcacgggcggc
atcgccacggtcaccaacttcggcggcttcggcctcacctttgccgcgcccatgcccatg
cccagcgaatccattatcctgggggtgggggccgtcaccaaaaccccggtctggagtgac
gaagtggaggcgtttatccccatctccaaggccaacatcgtggctacgggagaccaccgc
gtggtggacggagcggacatcggccgcctgctcaagcgcgtggcggaattgctccagcgc
ccggaatacctgtaa

DBGET integrated database retrieval system