KEGG   Akkermansia muciniphila: Amuc_1325Help
Entry
Amuc_1325         CDS       T00736                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
amu  Akkermansia muciniphila
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:amu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Amuc_1325
DNA repair and recombination proteins [BR:amu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Amuc_1325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1603615..1604223)
Genome map
AA seq 202 aa AA seqDB search
MNNLDYPIPVLELVTALKQLPGIGTRGAERMALWMLQGHMGEAEAIARTIGQAAEHVTPC
PVCGFFSTEGEPCAACRDEERDSRLICVVEQATDVIPIERSSAYRGLYHCLGGKLSPLDD
VEPEDLNIQSLVERVSRQPDCEVILATGSDVEGEATATYLHHLLKEMDCRISRPAQGLPA
GSGLSHADTLTLMKALEGRTRL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaataatctggactatcccatccccgtgcttgaactggtaaccgccctgaaacagctt
ccgggcatcggcacccgcggcgcggaacgcatggccctgtggatgctccaggggcacatg
ggagaagcggaggcgattgcccgcaccatcggccaggcggcggaacacgttacgccctgc
cccgtctgcggcttcttcagcacggaaggggagccctgcgccgcctgccgggatgaagaa
cgggacagccgcctcatctgcgtggtggaacaggccacggacgtcatccccattgaacgc
agcagcgcctaccgcggattgtaccactgcctgggcggcaagctttcccctctggatgat
gtggagccggaagacctcaacattcaatccctggtggaacgcgtctcccggcagcctgat
tgcgaagtcattctggcaacaggctctgacgtggaaggggaggcaacggccacctacctc
caccatctgctcaaagaaatggattgcaggatatcccgccctgcccaggggctgcctgcc
ggctccggcctcagccacgcggacacgctgacgctgatgaaggctctggaaggacgcacc
cggctgtaa

DBGET integrated database retrieval system