KEGG   Akkermansia muciniphila: Amuc_1386Help
Entry
Amuc_1386         CDS       T00736                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
amu  Akkermansia muciniphila
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:amu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1653674..1654513
Genome map
AA seq 279 aa AA seqDB search
MNWLVRRDVLEVARGGVLMGIVNVTPDSFSDGGRFYATERAVSHAKELERQGALILDIGG
ESTRPGAAEVSAEEELDRVLPVVRELRSCTDAVISVDTRHAAVAAAVLEAGADVINDISG
LREAGMAELCAAARCGVVAMHMQGRPETMQDAPSYGDVVREVRGYFEERYDFLLGRGLEP
EQICWDPGIGFGKTAEHNLALLSNMDKLQVAGRPVLLGLSRKRMLGAVLGDAEQGRAPLS
TAVMTVWGHLHGAQIHRVHDVAECARALRLIRAAEPFVR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaactggcttgtaaggagagacgtattggaggtggcgcgcggaggcgtgctgatggga
attgtgaacgttactccggattccttttccgacggagggcgtttttatgcgacggaacgc
gctgtctcccatgcaaaagagcttgaacggcagggcgcccttattctggacattgggggg
gagtccaccaggccgggggccgcggaggtttccgcggaggaggaattggacagggtgctg
cccgtggtgcgggaactccgttcatgcacggatgccgtgatttccgtggacacgcgccat
gccgccgtagcggcggctgtgctggaagcgggtgcggacgtcattaatgatatttccgga
ttgcgggaggcggggatggcggaattgtgcgctgcggcgcgctgcggcgtggtggcgatg
cacatgcagggacggcctgaaaccatgcaggacgctccttcttatggggatgtggtgcgg
gaagtgcgcggctattttgaggaacgttatgattttctgctggggcgggggctggaaccg
gagcagatctgctgggatcccggcatcggctttggcaaaacggcggaacacaatctggcc
ctgctgtccaacatggacaagcttcaggtggcaggccgcccggtgctgctgggcctttcc
cgcaagcgcatgctgggcgccgtcctgggggatgcggagcagggacgcgcgccgctgagc
accgccgtgatgacggtgtgggggcatttgcacggcgcgcagattcaccgtgtccatgac
gtggcggaatgcgcccgcgccctccggctgatccgggccgctgaaccgtttgtccgctga

DBGET integrated database retrieval system