KEGG   Akkermansia muciniphila: Amuc_1416Help
Entry
Amuc_1416         CDS       T00736                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
amu  Akkermansia muciniphila
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:amu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Amuc_1416
Enzymes [BR:amu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Amuc_1416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1694530..1695192
Genome map
AA seq 220 aa AA seqDB search
MTEAVPEDAFLACARAGLCHVKGMIAFLRGTVAESYPQRLILDVHGVGYEVIVPLSTFDR
LNPLPGRELTLKTYLHVRENMQVLYGFATDAERDIFLLLIERVSGIGPATAIAILGSLSV
EQFKQAVVGGDVSGIARAKGVGKKTAERIVLELKDKVGLAATWEAQAQGATSQAAGDAEL
ALIALGFKQVESRKAIAAHLKDHPDADVDELIRAALRSMN
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgacggaagcggttccggaggatgcgtttttagcttgcgcgcgggccggattgtgtcac
gttaagggtatgatagcttttctgcgcggcacggtggcggaatcatatccccagcggttg
atcctggatgttcatggggtggggtatgaagtgattgtgcccctgtccacgtttgacagg
ctgaatccccttcccggcagagagctgacgctgaaaacctacctgcatgtccgggagaac
atgcaggtgctgtacggttttgccacggatgcggaaagggatattttcctgctgctgatt
gaacgtgtttccggaatcggcccggcaacggcgattgccattttgggttccctgtccgtg
gagcagttcaagcaggcggttgtgggcggagatgtttccggcattgctcgggccaagggg
gtgggcaagaagacggcggaacgcatcgtcctggaactgaaggataaagtgggcctggcc
gccacgtgggaagcccaggcccagggcgctacttcccaggccgccggggacgcggaattg
gcgctgattgcgctcgggttcaagcaggtggaatcccgcaaggcgatagccgcccatctg
aaggaccatccggatgcagacgtggacgagctcatacgcgccgctttgcgttccatgaat
tga

DBGET integrated database retrieval system