KEGG   Akkermansia muciniphila: Amuc_1481Help
Entry
Amuc_1481         CDS       T00736                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
amu  Akkermansia muciniphila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Amuc_1481
   01230 Biosynthesis of amino acids
    Amuc_1481
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amuc_1481
   00030 Pentose phosphate pathway
    Amuc_1481
   00051 Fructose and mannose metabolism
    Amuc_1481
   00052 Galactose metabolism
    Amuc_1481
  Energy metabolism
   00680 Methane metabolism
    Amuc_1481
Enzymes [BR:amu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Amuc_1481
Protein phosphatases and associated proteins [BR:amu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Amuc_1481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1771023..1772102
Genome map
AA seq 359 aa AA seqDB search
MNIGVLNSGGDSPGLNAVIEGVVGAASRRGWNVVGFYDGFEGLLSEEGDERFEWLTPAAC
RGLRAKGGTILGTVNKGNFAIKVGVDQKGAIEPAVLEKTKATVRRLGLDALIVVGGDGSQ
STALLLSEIGLPVVGVPKTIDNDLGATDVTFGFYSAVSIVSESLDRLETTANAHQRMMVV
EVMGRHAGWIALEGGIAGSADVILLPEIPFSLENVVECIKARKAAGQREILVVVSEGARL
ADELVLLDEKTQGEVRLGGIGKVIAKKLEEATGIETRSCVLGHIQRGGSPCSYDRILGTR
FGSYAVELVEKRQFSCMVALRGTQMTAVPIEEAVKTLKLVDPDCQLVRTARDLGVCFGD
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcggtgttttgaatagcgggggtgactcccccgggttgaatgcagttattgaa
ggtgttgtgggcgcggcttcccgtcgcggctggaacgttgtgggtttttacgacggtttt
gaagggcttttgtccgaggaaggggacgaacggtttgaatggctgacccctgccgcctgc
cgcggattgcgagccaaggggggcaccattctgggaaccgtgaacaaaggaaacttcgcc
atcaaagtaggcgtggaccaaaagggggcgattgaacccgcggtgctggaaaaaacgaag
gctactgtccgccggctgggactggatgccctgatcgttgtgggcggagacggctcccag
tccacggctcttttgctttccgagatagggctccccgtagttggcgtgccaaaaaccatt
gataatgacctgggcgcaaccgatgtcacttttggcttctacagcgccgtttccattgtt
tccgagtctttggaccgtctggaaaccactgcaaacgcgcaccagcgcatgatggtggtg
gaagtgatgggacggcatgcgggatggattgccttggaaggcggcatcgcagggagtgct
gatgttattcttctgccggaaattcctttttcccttgaaaacgtggtggaatgcatcaag
gcgcgcaaggctgccgggcagcgggaaatcctggtggtggtatctgaaggggcccgtctg
gcggacgaactggtattgctggatgaaaagacccagggggaagttcgcctgggtggcatc
ggcaaggtgattgccaagaaactggaagaagccactgggattgaaacccgctcctgcgtg
ctgggccatatccagcgcggcggttctccctgttcctatgaccggattctgggaacgcgg
ttcggcagttatgccgtggaactggtggaaaagcgccaattcagctgcatggttgctctc
cgtgggacgcagatgactgccgtacccattgaggaagctgtgaaaaccttgaagctggtg
gatcccgattgtcagctggtgcgcacggcccgcgatttgggcgtatgcttcggggactga

DBGET integrated database retrieval system