KEGG   Akkermansia muciniphila: Amuc_1489Help
Entry
Amuc_1489         CDS       T00736                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
amu  Akkermansia muciniphila
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:amu00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1779046..1779648
Genome map
AA seq 200 aa AA seqDB search
MTAMKQPLGTLLVVSGPSGSGKTTLCRRATENGLCVYSISCTTRQPRPGEVNGVDYHFLT
PAEFDARVERGDFLEYAEVHGNRYGTLKADILTLLEQGKNVVMDIDVQGAGQVRSCREGI
LPLCYVDVYIYVPQAELKNRLCGRQTDGAETIALRLRNAEQEDACLPQYQYCLVSSDRET
DYASFCALLKCQSMRVGLMR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgacagccatgaaacagccattgggaacattgctggtggtatccgggccttccggttcc
gggaagacgacgttgtgccgccgcgcgacggaaaacggtctgtgtgtgtacagcatttcc
tgcacgacgcgccagcccagacccggggaagtcaatggagtggattaccatttcctgact
cccgccgaatttgacgccagggtggagcggggagactttctggaatatgcggaggtgcac
ggcaaccgctacggtacgctgaaagcggatattttgactcttctggaacaggggaaaaac
gtggtgatggatattgacgtgcagggggctgggcaagtccgttcctgccgggagggcatt
ctacccctctgctatgtggacgtttacatttatgtgccgcaggcggagcttaaaaaccgc
ctttgcggacggcagacggatggcgctgaaaccattgccctgcgtcttcgcaatgcggaa
caggaagacgcctgcctgccgcagtaccagtactgcctggtttcctccgaccgcgagacg
gattatgcttccttttgcgccctgctcaaatgccagtccatgcgggtgggactgatgcgg
tga

DBGET integrated database retrieval system