KEGG   Akkermansia muciniphila: Amuc_1522Help
Entry
Amuc_1522         CDS       T00736                                 

Definition
type III restriction protein res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
amu  Akkermansia muciniphila
Brite
Enzymes [BR:amu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Amuc_1522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1820014..1823040
Genome map
AA seq 1008 aa AA seqDB search
MKFKFKIQQYQTEAVENTVAVFTGQPSYAIEGYRLDRGRQAQRQLDFDDETGYRNHCVEL
DGKALLKNINTIQNLYDITPSSSLSKGIGAVNLDIEMETGTGKTYVYIKTMFELNKQYGW
SKFIVVVPSIAIREGVAKSFRMLEEHFMEHYGKKARWFIYNSGNLQQLDSFSSDSGLSVM
IINTQAFASSMKEGGRSKESRIIYSERDEFGSRRPIDVIAANRPIIIMDEPQKMEGDATQ
AGIKRFNPLFVLNYSATHTTRHDTIYALDALDAYRQKLVKRIHVKGFEVKNLRGTSGYLY
LDNIVLSPKRPPEARIELEVKNASGSIVRKIKTFGVGDNLREESGLAEYDNFVVSEINMN
GYVTFLNGVTIRRGEVIGDPDELDMQRVQIRETIMSHLEKERQLFKRGIKCLSLFFIDEV
AKYKSYDENGEEVKGVFQKMFEEEYARLVNEEFYIWDEDYNEYLRRFLPQDVHRGYFSID
KKTNRVIDGKVEKKTGLSDDISAYDLILKNKERLLSFEEPTRFIFSHSALREGWDNPNVF
QICTLRHSNSSTAKRQEVGRGLRICVDRNGVRMDKELLGEDVHEVNKLTVIANESYADFT
TALQKETREVLRERAAKATVAYFQDRQIKIGEEIHTITETEASRIIIYLEDNGYIDEDKH
ITPDYREAVANGTVAPLPPRLQPIAEGVVRLINSIFDPKALDDMVVEEKTTTPDNKLNEN
FQKAEFQALWNEINHQYVYTVSYDSNELIEKAILHINSELEVKRLRYVMVEGTQDEEQVT
DFGDTRSQSRQLTDVCTSTVRYDLVGDIAKGANLTRRTVVKILQGIQTSKLYLFKNNPEE
FIRKAVSIIKEQKATMIVEAIRYNMTEGKYDSSIFTVKSRMDFDRAYEAKKHITDYVFSD
SKGERQFAHDLDEAHEVVVYAKLPRTFQIPTPVGNYAPDWAIAMTKDGVKHIFFIAETKG
SMSSMDLSAIEKAKIACAEKLFNSISTANVKYHKVATYQDLIDEMNAG
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcaagtttaagatacaacaatatcagacggaggcggtggagaataccgtggct
gtcttcacggggcagccctcgtacgccatagagggatatcgcctcgaccgcggacggcag
gcacaacgacagttggatttcgatgatgaaacaggatacaggaaccactgcgtggaactg
gatgggaaagccctgttgaaaaacatcaataccattcagaatctgtatgacatcacgccg
tcttcttccctttcaaagggtatcggtgcggtgaatctcgacatagagatggagaccgga
acgggaaagacatacgtctatatcaagacgatgtttgagctgaataaacagtacggctgg
agcaaattcatcgtggtggtgccgagcatcgccatccgtgagggcgtggcaaagagtttc
cgcatgttggaggagcacttcatggaacactacggcaagaaagcgcggtggttcatttac
aacagcggcaacctgcaacaactcgacagtttttcatctgattccgggttgagcgtgatg
attatcaacacgcaggctttcgcctcctcgatgaaggagggcggcagaagcaaggagagc
aggattatttactccgagcgtgatgagttcggcagccgccgtcccatagacgtgattgcc
gccaaccgtcccatcattatcatggacgaaccgcagaagatggagggcgatgccacgcag
gcgggcatcaaacgcttcaacccactgttcgtgctgaactattcggctacgcacacgacc
aggcacgataccatctatgcgctggatgctttggacgcttaccggcagaagctggtgaag
cgcattcatgtgaaaggttttgaagtgaagaacctccggggaacgagcgggtatctctat
ctcgacaacatcgtgttgtcgcccaaacgtccgccggaagcgcgcattgagctggaggtg
aagaatgcttcaggcagcatcgtcaggaagataaaaacattcggcgtgggcgacaacctg
cgcgaagagtccgggctggccgagtacgacaactttgtggtgtcggaaatcaacatgaac
ggctatgtgacctttctcaacggcgtgaccatacgcaggggcgaggtgataggcgacccg
gatgagctggacatgcagcgggtgcaaatccgggagaccatcatgtcgcacttggagaaa
gaacgccagcttttcaagcggggcatcaagtgcctgtccctctttttcatcgacgaggtg
gcgaagtacaagagctacgatgagaacggggaggaagtgaaaggcgtgttccagaaaatg
ttcgaggaggaatatgcgaggttggtgaatgaggagttctacatctgggatgaggactac
aacgaatacctccgccgtttcctgccccaggacgtgcatcggggttatttctccatagac
aaaaagactaaccgggtgattgacggcaaggtggaaaagaagacgggactgtcagacgac
atttccgcttacgaccttatcctgaagaacaaggaacgcctgctgagctttgaggagccg
acacgcttcatcttctcgcactcggcactgcgtgaggggtgggacaatcccaatgtattt
cagatttgcacgctgcgccattccaactcctccaccgccaaacgtcaggaggtagggcgc
ggtttgcgtatctgcgtggacaggaacggcgtgcgcatggacaaggaactgctgggggaa
gacgtgcatgaggtgaacaaactgaccgtgatagccaacgagagctatgcggattttacc
acagccctgcaaaaggagacacgggaagtgttgcgtgagcgcgcagccaaggcaacggtc
gcctattttcaagacaggcagattaagattggggaggaaatacataccattaccgaaacg
gaagccagccgcatcatcatctatctggaagacaacggctatattgacgaggacaagcac
atcacgccggattaccgtgaggccgtggcaaacggcacggtggctccattgccgcccagg
ctgcaaccgatagctgagggggtagtccgtctgataaactccatcttcgacccgaaggca
ctcgacgacatggtggtggaggagaagacaaccacgccggacaacaaacttaacgaaaac
ttccaaaaagccgaattccaagctttgtggaacgagataaaccaccagtatgtttatacg
gtaagctacgacagcaacgagctgatagaaaaagccatcctgcacatcaattccgaactg
gaggtaaagcggctccgctatgtgatggtggagggaacgcaggatgaggagcaggtaact
gacttcggagacacccgttcccaatccaggcaactgaccgatgtctgcacttccaccgtc
cgctacgaccttgtgggcgacatagccaaaggcgccaatctcacccgccgcacagtggtg
aagatactgcaaggcatccagacgagcaagctttacctgttcaagaacaaccccgaggag
tttatccgcaaggctgtaagcatcatcaaggagcagaaggccacgatgattgtggaggcc
atccgctacaacatgacggaaggcaaatacgacagcagcatcttcaccgtgaagagcaga
atggattttgaccgggcatacgaggcgaagaagcatatcaccgattatgtgttcagcgac
agcaagggggaacgccaattcgcccatgaccttgacgaggcccatgaagtggtggtctat
gccaaactgccccgtactttccaaatacccactccggtaggcaactatgcccccgactgg
gctatcgctatgacgaaagacggagtgaaacacatctttttcattgccgagaccaaaggc
tccatgtcatcaatggatttgagtgccatcgaaaaggcaaaaatcgcatgtgcggagaag
ttgttcaactctatctcaacggcaaatgtgaagtatcacaaagtggctacctatcaggat
ttgattgatgagatgaacgcggggtaa

DBGET integrated database retrieval system