KEGG   Akkermansia muciniphila: Amuc_1533Help
Entry
Amuc_1533         CDS       T00736                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
amu  Akkermansia muciniphila
Pathway
amu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amu01100  Metabolic pathways
amu01110  Biosynthesis of secondary metabolites
amu01130  Biosynthesis of antibiotics
amu01230  Biosynthesis of amino acids
Module
amu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Amuc_1533
Enzymes [BR:amu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Amuc_1533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ACD05354
JGI: Amuc1533
UniProt: B2ULG7
Position
1835875..1836660
Genome map
AA seq 261 aa AA seqDB search
MLLDRFREAKAEEIALLTDMASRRELPRPWKGRRPDFLKAIAEPPDGQPVAVIAEFKQSS
PSRGVIATGLKPEEVAEQYAAAGASCISVLTEEQFFGGRIGYLERMSRAGLPLLRKDFIF
HQLQVMETASTPASALLLIVRLTPDARTLRVLREQAEAYGMHAVVEVFDAADLEIARDSG
ARIIQVNARDLDTLKTDRQACLDMAKFRREGEVWIAASAMSAGAHLREAAEAGFQAVLMG
TALMDGGRPGEKLAAILEETI
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttgaccggttccgggaagcaaaggcggaggaaatagccctgctcacggacatg
gcctcccgccgggaactgccgcgcccgtggaaggggcgccggccggatttcctgaaagcc
attgcggaaccgccggacgggcagcccgtggcggtcattgcggagttcaagcagtcctct
ccgtcgcgcggtgtcatcgccaccgggctgaaaccggaggaagtggctgaacaatacgct
gcggcaggcgcctcctgcatctccgtgttgacggaagaacagtttttcggcggccgcatc
ggatatttggaacgcatgagccgcgccgggcttccgcttctccgcaaggatttcattttt
catcagcttcaggtgatggagacggcttctacgccggcttccgctttgctgctcattgtc
cgtctgacgccggatgcacggacgctccgtgttctcagggagcaggcggaggcttacggc
atgcacgccgttgtggaagtgttcgacgctgcggatctggaaattgccagggactccggc
gcgcgcatcatccaggtaaacgcccgtgacctggacacattgaaaacggacaggcaggcc
tgcctggacatggcgaaattccgccgtgagggggaggtgtggatcgccgccagcgccatg
agcgcaggggctcatctcagggaagccgcggaagcggggtttcaggccgtactgatggga
acagccctgatggacggaggaaggccgggtgaaaaactggcggcaattttagaagaaacg
atatga

DBGET integrated database retrieval system