KEGG   Akkermansia muciniphila: Amuc_1533Help
Entry
Amuc_1533         CDS       T00736                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
amu  Akkermansia muciniphila
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:amu01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:amu00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1835875..1836660
Genome map
AA seq 261 aa AA seqDB search
MLLDRFREAKAEEIALLTDMASRRELPRPWKGRRPDFLKAIAEPPDGQPVAVIAEFKQSS
PSRGVIATGLKPEEVAEQYAAAGASCISVLTEEQFFGGRIGYLERMSRAGLPLLRKDFIF
HQLQVMETASTPASALLLIVRLTPDARTLRVLREQAEAYGMHAVVEVFDAADLEIARDSG
ARIIQVNARDLDTLKTDRQACLDMAKFRREGEVWIAASAMSAGAHLREAAEAGFQAVLMG
TALMDGGRPGEKLAAILEETI
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttgaccggttccgggaagcaaaggcggaggaaatagccctgctcacggacatg
gcctcccgccgggaactgccgcgcccgtggaaggggcgccggccggatttcctgaaagcc
attgcggaaccgccggacgggcagcccgtggcggtcattgcggagttcaagcagtcctct
ccgtcgcgcggtgtcatcgccaccgggctgaaaccggaggaagtggctgaacaatacgct
gcggcaggcgcctcctgcatctccgtgttgacggaagaacagtttttcggcggccgcatc
ggatatttggaacgcatgagccgcgccgggcttccgcttctccgcaaggatttcattttt
catcagcttcaggtgatggagacggcttctacgccggcttccgctttgctgctcattgtc
cgtctgacgccggatgcacggacgctccgtgttctcagggagcaggcggaggcttacggc
atgcacgccgttgtggaagtgttcgacgctgcggatctggaaattgccagggactccggc
gcgcgcatcatccaggtaaacgcccgtgacctggacacattgaaaacggacaggcaggcc
tgcctggacatggcgaaattccgccgtgagggggaggtgtggatcgccgccagcgccatg
agcgcaggggctcatctcagggaagccgcggaagcggggtttcaggccgtactgatggga
acagccctgatggacggaggaaggccgggtgaaaaactggcggcaattttagaagaaacg
atatga

DBGET integrated database retrieval system