KEGG   Akkermansia muciniphila: Amuc_1536Help
Entry
Amuc_1536         CDS       T00736                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
amu  Akkermansia muciniphila
Pathway
amu00260  Glycine, serine and threonine metabolism
amu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amu01100  Metabolic pathways
amu01110  Biosynthesis of secondary metabolites
amu01130  Biosynthesis of antibiotics
amu01230  Biosynthesis of amino acids
Module
amu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Amuc_1536
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Amuc_1536
Enzymes [BR:amu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Amuc_1536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: ACD05357
JGI: Amuc1536
UniProt: B2ULH0
Position
1838487..1839275
Genome map
AA seq 262 aa AA seqDB search
MNNMQKSPLQKAVERAHALGRRAVIPFITAGFPDKESFWTHLSRIDEAGADIIEIGVPFS
DPVADGPVIEQASRDALARGVSLKWILDGLKARKGGFSAELVLMGYVNPFYQYGLEQLAL
DAEEAGVSGFIVPDMPLEESGMFREAFSPHGLTLVTLVAPNTSVERMREYKPYTSGFVYV
VSVLGTTGGKANLERSVTETMRRARSVFDVPLALGFGLQTPDQLETLPEDARPDAAVLGS
ALLRHIGEGKDAGEFLEKWTRG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatgcagaaatcaccgttgcagaaagccgtggagagggcccatgccctcggc
aggcgtgccgttatccctttcattaccgccggattcccggacaaggaatccttctggacg
cacttgtcccgtattgacgaagccggggcggatattattgagataggagttcccttctcg
gatcccgtagcggacggcccggttattgaacaggcatcccgggatgccctggcccgcggc
gtcagcctgaaatggattctggacggtctgaaagcccgcaagggcggtttttcagccgaa
ctggtgctgatgggatacgtaaatcccttttaccagtatggcctggaacagcttgccctg
gatgcggaggaggcgggcgtcagcggtttcatcgtaccggatatgccgctggaggaatcc
ggaatgttccgggaggctttcagcccccatggcctgacgctcgtcactctggtggctccc
aatacttccgtggaacgcatgcgggaatacaagccttatacttccggcttcgtttatgtg
gtctccgtgctgggaaccaccggtgggaaagccaacctggagcggagcgttacggaaacc
atgcgccgtgcccggtccgtttttgatgtgccgctggcgctgggcttcgggcttcagacg
ccggaccagctggagacgctgcctgaagatgcccggccggatgccgccgtgcttgggagc
gctctgctcaggcacattggagaagggaaggacgccggggaatttttggaaaaatggacc
agaggttga

DBGET integrated database retrieval system