KEGG   Akkermansia muciniphila: Amuc_1536Help
Entry
Amuc_1536         CDS       T00736                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
amu  Akkermansia muciniphila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:amu01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:amu00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:amu00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1838487..1839275
Genome map
AA seq 262 aa AA seqDB search
MNNMQKSPLQKAVERAHALGRRAVIPFITAGFPDKESFWTHLSRIDEAGADIIEIGVPFS
DPVADGPVIEQASRDALARGVSLKWILDGLKARKGGFSAELVLMGYVNPFYQYGLEQLAL
DAEEAGVSGFIVPDMPLEESGMFREAFSPHGLTLVTLVAPNTSVERMREYKPYTSGFVYV
VSVLGTTGGKANLERSVTETMRRARSVFDVPLALGFGLQTPDQLETLPEDARPDAAVLGS
ALLRHIGEGKDAGEFLEKWTRG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatgcagaaatcaccgttgcagaaagccgtggagagggcccatgccctcggc
aggcgtgccgttatccctttcattaccgccggattcccggacaaggaatccttctggacg
cacttgtcccgtattgacgaagccggggcggatattattgagataggagttcccttctcg
gatcccgtagcggacggcccggttattgaacaggcatcccgggatgccctggcccgcggc
gtcagcctgaaatggattctggacggtctgaaagcccgcaagggcggtttttcagccgaa
ctggtgctgatgggatacgtaaatcccttttaccagtatggcctggaacagcttgccctg
gatgcggaggaggcgggcgtcagcggtttcatcgtaccggatatgccgctggaggaatcc
ggaatgttccgggaggctttcagcccccatggcctgacgctcgtcactctggtggctccc
aatacttccgtggaacgcatgcgggaatacaagccttatacttccggcttcgtttatgtg
gtctccgtgctgggaaccaccggtgggaaagccaacctggagcggagcgttacggaaacc
atgcgccgtgcccggtccgtttttgatgtgccgctggcgctgggcttcgggcttcagacg
ccggaccagctggagacgctgcctgaagatgcccggccggatgccgccgtgcttgggagc
gctctgctcaggcacattggagaagggaaggacgccggggaatttttggaaaaatggacc
agaggttga

DBGET integrated database retrieval system