KEGG   Akkermansia muciniphila: Amuc_1536Help
Entry
Amuc_1536         CDS       T00736                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
amu  Akkermansia muciniphila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Amuc_1536
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Amuc_1536
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Amuc_1536
Enzymes [BR:amu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Amuc_1536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1838487..1839275
Genome map
AA seq 262 aa AA seqDB search
MNNMQKSPLQKAVERAHALGRRAVIPFITAGFPDKESFWTHLSRIDEAGADIIEIGVPFS
DPVADGPVIEQASRDALARGVSLKWILDGLKARKGGFSAELVLMGYVNPFYQYGLEQLAL
DAEEAGVSGFIVPDMPLEESGMFREAFSPHGLTLVTLVAPNTSVERMREYKPYTSGFVYV
VSVLGTTGGKANLERSVTETMRRARSVFDVPLALGFGLQTPDQLETLPEDARPDAAVLGS
ALLRHIGEGKDAGEFLEKWTRG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatgcagaaatcaccgttgcagaaagccgtggagagggcccatgccctcggc
aggcgtgccgttatccctttcattaccgccggattcccggacaaggaatccttctggacg
cacttgtcccgtattgacgaagccggggcggatattattgagataggagttcccttctcg
gatcccgtagcggacggcccggttattgaacaggcatcccgggatgccctggcccgcggc
gtcagcctgaaatggattctggacggtctgaaagcccgcaagggcggtttttcagccgaa
ctggtgctgatgggatacgtaaatcccttttaccagtatggcctggaacagcttgccctg
gatgcggaggaggcgggcgtcagcggtttcatcgtaccggatatgccgctggaggaatcc
ggaatgttccgggaggctttcagcccccatggcctgacgctcgtcactctggtggctccc
aatacttccgtggaacgcatgcgggaatacaagccttatacttccggcttcgtttatgtg
gtctccgtgctgggaaccaccggtgggaaagccaacctggagcggagcgttacggaaacc
atgcgccgtgcccggtccgtttttgatgtgccgctggcgctgggcttcgggcttcagacg
ccggaccagctggagacgctgcctgaagatgcccggccggatgccgccgtgcttgggagc
gctctgctcaggcacattggagaagggaaggacgccggggaatttttggaaaaatggacc
agaggttga

DBGET integrated database retrieval system