KEGG   Akkermansia muciniphila: Amuc_1621Help
Entry
Amuc_1621         CDS       T00736                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
amu  Akkermansia muciniphila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Amuc_1621
Enzymes [BR:amu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Amuc_1621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1951396..1953267)
Genome map
AA seq 623 aa AA seqDB search
MRSDMDEKRLAGVVLPLFSLRRNNDHGIGDLTALRQWIDWAADAHVGFLQLLPVNALGRD
ECPSPYSAISSVALEPLYLSLEPWTIPGLEERVFNETGDTLPWEQPSGPDLVDYPKVRFW
KMWILRGAWNNFKTKPEYECIMPKFREWVKEQGSWLEDFVCFQILCDLFGTEIWWHWPEQ
DPARAKAIAADYEEEKDFARWLQWLCEKQWEFIRIYADERNVKLMGDIPIGVSLSSADVF
FERHLFDTEWCGGAPAEGSYAEDPFTAKWGQNWGIPLYRWDVMAQDNFAWWRRRVKYCTK
IFSMYRIDHILGFYRIYSFPWKPTENGVFLPLSPDQAAQRTGGRLPGFKPRGDDNAADRN
MNLADGDLYLRLLLSAAPGVSVVGEDLGCVPDYVRPNMRQLDIPGFKIPHWEIKADGTIT
SGKEYHECSFAAFGTHDFETIMQTWNDSYAKIERARKLGLWENGSPKTPSSPEQENIVRQ
AEDGARLLKWFADFSGMQPETCLSYWNQEIKTAMYNALFRSRSRYAAILWPALFGINKRL
NIPGTTGGTNWRERMPFKAVEACGMPQTAWLRTIIDESGRTPLQGEDAIRALKESSKRLF
PKITVNNERFLKRMLMWPNGKTL
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgcgttctgatatggatgagaaaagattagccggcgtagttctgccattgttctccctg
cgccgtaacaatgaccacggaatcggggacctgacggccttgcgccaatggattgactgg
gcggcggatgcccatgtggggttcctccagctgctccccgtcaatgccctgggcagggac
gaatgcccctctccctattccgccatcagctccgtagctttggaacccctgtacctttcc
ctggaaccctggaccatacccggcctggaagaacgcgtattcaatgaaacgggggacacg
ctgccgtgggaacagccctccggcccggatctggtggactaccccaaggtcagattctgg
aaaatgtggattctgcggggagcctggaacaatttcaaaaccaagccggaatatgagtgc
attatgcccaaattcagggaatgggtgaaagaacaggggagctggctggaagactttgtc
tgtttccagattctctgcgacctgttcggcacggaaatctggtggcactggccggaacag
gatccggcgcgggccaaggccattgccgccgattacgaggaagaaaaggattttgcccgc
tggctccagtggctctgtgaaaaacagtgggaattcatccgtatttatgcggacgaacgc
aatgtgaagctgatgggggatatccccattggcgtttccctttccagcgccgacgtcttt
tttgaacgccacctgtttgacacggaatggtgcggaggagccccggcggaaggcagctat
gcggaagacccattcacggccaaatgggggcaaaactggggcattccgctgtatagatgg
gatgtcatggcgcaggacaacttcgcctggtggcgccgccgggtaaaatactgcaccaag
attttcagcatgtacaggatcgaccacatcctgggcttttaccgcatttactccttcccg
tggaaacccacggaaaacggggtcttcctgccgctttcccccgatcaggctgcccagaga
acgggcggaaggctgcccggcttcaagccgcgcggggatgacaatgcagcggaccgcaac
atgaacctggcggacggggacctgtacctgcgccttctgctttccgccgcccccggcgtc
agcgtggtgggggaagacctgggctgcgttccggactacgtgcgcccgaacatgcggcag
ctggatatccccggtttcaaaattccccactgggaaatcaaggcggacggaaccattacg
tctggaaaagaatatcacgaatgctcctttgcggcgttcggaacgcatgatttcgaaacc
atcatgcagacatggaacgacagctacgcgaaaatcgaacgcgcccgcaagctgggcctg
tgggagaacggctccccaaaaacgccgtccagcccggaacaggaaaacatcgtgcgccag
gcggaggacggagcgcgccttctgaaatggtttgcggatttctccggcatgcagcctgaa
acctgtctttcctactggaaccaggaaatcaagacggccatgtacaacgctctgttccgt
tcccgttcccgttatgcggccattctctggcctgctctcttcggcatcaacaaacggctc
aatattcccggcactacgggagggaccaactggagggaacgcatgcccttcaaggccgtg
gaagcatgcggcatgccacagaccgcatggctgcgcaccatcatcgacgaatctggccgc
acgccgctgcagggtgaagacgccatcagggcgctcaaggaatccagcaaacgcctcttc
ccgaagatcaccgtcaacaacgaacgcttcctgaaacggatgctgatgtggccgaacggc
aaaacattgtag

DBGET integrated database retrieval system