KEGG   Akkermansia muciniphila: Amuc_1666Help
Entry
Amuc_1666         CDS       T00736                                 

Definition
glycoside hydrolase family 2
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
amu  Akkermansia muciniphila
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:amu00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:amu00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:amu00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2013730..2017599
Genome map
AA seq 1289 aa AA seqDB search
MKTVRAFLFSVMCLAPALPLLGDVPDWENEEVTGINKEAPRASVFPASDKTLSLNGDWKF
KFSMTPDERPADFFNPSYSVSGWDTVKVPSNWQLYGYGTAIYTNVPYPFKPNPPKVMGEP
PKNWPAYRERNSVGSYRRDFNLPVSWKGEQVMIRFDGVESAFYVWVNGRQVGYSEDSYTG
AEFDLTPYVRPGRNTIAVEVYRWSDGSYLEDQDFLRLSGIFRDVTLFAQPQTHVRDLFLK
AGLDREDYTTGVLDGTFTIRNSGKKDIPAGMKLNYSIDGISTKLNWEGRNGSGRVQTDNR
GRLDSGTLEVPSIPSGGEVQISLNRKFPGVKPWTAETPNLYRVTYSLNGKDTRSVNIGFR
SVEIADNGAVLINGRAVKFKGVNRHEAHPDYGRAIPREVMEKDVQIIKAHNINTVRCSHY
PNHPYFYELCDRYGLYVMDEANCEAHGIRNSSMDISRKPSWKKAHVERNMSMVHRSKNHP
SIVFWSLGNESGNGPNFEAAAAAVRAYDTTRPLHYCEFPHGHKAVDMDSAMYPPVDRVEN
WGKQKTSRPFFVCEYAHSMGNALGNFKEYMDAFESSPRMVGGAIWDFVDQSLRANPAGNG
IYKPAPFKGVTQAYGGMFGDRPNQANFCDNGIILGNRNTTAKTKEVKKVYQYMAFERKDG
SLSVRNKYFHKPLKGYTLYLVSLVPGGGHAVERMVLPEVPPGKSATVNLPSAAMRTGSLM
VLADARFKLPEDVKELSSKQLEHVVNECEAYEWFPASAEKEVPVPPPAALPAVSVLQGDS
VAVQGKGFSASFKNGMLSSLRYGGRDLILPGYPVELQAYRSPVDNDAWIRSKVEGKMKMQ
NMKAEYSDVKAAVISPGVARITAQFRTKGSELAFSGEVAWTVFGNGIINASVRMYPSAKG
EELLRLGVTFGMPAAYDRVEYLGLGPWDNYRDRRTSCWKDIFRTSVDDMFFAYSRPQDMG
NRMETDWIALSKPQEDQALWVGAASPRAPLEVSVLRYTPKELNDARSLDRLPEKNKVIVN
LDAFQMGLGGSSCGPRPLVKYQTLSGATALGFVLAPSSALLNLARTGLAVPHSPVIERDG
DGMVSLTSSTPEAEIKYSVNKGPEKTYRNPFKLPEGEVRAWAASMKSGKVPSTSPGERKF
PLVKGQGEWKILSASSEEPDTGFAHFAIDGNPDTYWHTSYTNGLPGFPHSIAVDMGTRMK
FTGFIYTPRMDKDKGLISQYTFSVSDDGRNWREVKKGQFSYHYIRKDPAVQRIDFGRPVE
ARYFKLDARSPVRGGEQSATVAELNIITQ
NT seq 3870 nt NT seq  +upstreamnt  +downstreamnt
atgaagacggtacgcgcgtttctgttttccgtgatgtgtctggctccggctcttcccctg
ctgggggatgttccggattgggaaaatgaagaggtgacgggaatcaataaggaggctccc
cgagcctccgtttttccggcatcggataaaacgttgagcttgaacggggattggaagttc
aaattttccatgactccggacgagaggcctgccgatttcttcaatccctcttattccgtt
tccggatgggatacggtcaaggttccttccaactggcagctttacggttatggaacggcc
atttacacgaatgttccctatccattcaagccgaatcctcccaaggtaatgggggaaccg
cccaagaactggccggcgtacagggagcgtaattccgtgggttcctaccgccgggatttc
aatttgcccgtttcctggaagggagagcaggtgatgatccggtttgacggggtggagtcc
gccttttatgtgtgggtaaatggccgtcaagtcggctattccgaagattcctatacaggg
gcggagtttgaccttactccctatgtcaggcccggcaggaatacgattgccgtggaagta
taccgctggagcgacggttcttacctggaggaccaggatttcctgcgcctttccggcatt
ttccgggacgtgaccctgtttgcccagccgcagacgcacgtgcgtgacctgttcctgaag
gccggactggacagggaggattacacaaccggggtactggacggaacgttcaccatccgc
aattccggtaaaaaggatattcccgccggcatgaagctgaattattccatcgacgggatt
tccaccaaattgaactgggagggcaggaacggttccggccgcgtgcagacggacaacagg
ggaaggctggattccggaacgctggaggttccctccattccctccggaggcgaggtgcag
atttccctgaacaggaaatttcccggtgtgaagccatggacggcggaaacgcccaacctg
tacagggtgacttattctctgaatggaaaggatacccgttccgtcaatatcgggttccgt
tccgtggagattgcggataacggcgccgtgctgattaacggcagagccgtcaagttcaag
ggtgtcaaccgccatgaagcccatcccgattacgggcgcgccattccgcgggaagtgatg
gaaaaggacgtgcagattatcaaggcgcataatatcaataccgtccgttgttcccactat
cccaatcatccttatttttatgagttgtgcgaccgctacggcctgtacgtgatggacgaa
gccaactgcgaagcccacggcatccgcaatagcagcatggatatttcccggaagccttcc
tggaagaaagcccatgtggagcgcaatatgagcatggtgcatcgttccaagaaccaccct
tccattgttttctggtccctgggcaatgagtccggaaacggtcccaattttgaggcggca
gcggcggctgtcagggcttatgacactacgcggcccctccattactgcgaatttccgcac
ggccacaaggccgtggatatggattccgccatgtatccgcccgtggaccgggtggaaaac
tgggggaagcagaaaacttcccgcccctttttcgtgtgcgaatatgcccactccatgggg
aatgccctggggaatttcaaggagtacatggatgccttcgagtcttccccgcgcatggtg
ggcggggccatctgggatttcgtggaccagtccctccgcgccaatcctgccggaaacggc
atttacaagcccgcccctttcaagggagtaacacaggcttacggcggcatgttcggagac
aggcccaaccaggccaatttctgcgacaacggcattattcttggcaaccggaacaccacg
gccaagacgaaagaggtgaagaaagtataccagtacatggcttttgagcgcaaggacggg
tccctgtccgttcgcaacaaatatttccataagcctttgaaaggttatacgctttatctg
gtatcccttgttcccggcggcggccatgccgtggagcgcatggttctgccggaggttccc
cccggcaaatccgcaacggttaatctgccttcagccgctatgcggaccggttccctgatg
gttctggcggatgcccggttcaagctcccggaagacgtgaaggaactttcctccaagcaa
ctggaacatgtggtgaatgagtgcgaagcttacgagtggttcccggcatctgcagagaag
gaggttcccgtgcctcccccggcggcgctgcctgctgtttccgtgctccagggggattcc
gtggccgtgcagggaaaaggtttttccgcctccttcaaaaacgggatgctttcctccctc
cggtatggcggtcgggatttgattttgcccggctatccggtggagctccaggcgtaccgt
tctccggtggataacgatgcctggatcaggagcaaggttgaagggaaaatgaagatgcag
aatatgaaagcggaatattccgacgttaaagctgccgtcatttcccccggcgtggcccga
atcacggcacagttccggacgaaaggttccgagcttgccttttccggggaagtcgcgtgg
acggttttcggcaacggcattatcaatgcttccgtccgaatgtatccctccgccaaggga
gaagaactccttcggctgggcgtcactttcgggatgcctgccgcgtatgaccgggtagag
tacctggggctgggaccgtgggataattaccgggaccgccgcacgagctgctggaaggac
attttccgcacttccgtggacgatatgttttttgcttattcccggccccaggatatgggc
aaccgcatggaaacggactggatagccttgtccaaaccccaggaggaccaggctctgtgg
gtgggggccgcctctcccagggctccgctggaggtttccgtcctgcgttatacgccgaag
gagcttaacgatgccaggagcctggacaggctgccggagaaaaataaagtgattgtgaat
ctggacgctttccagatggggctgggcggctcttcctgcgggccccgtccgctggtcaag
taccagacattgagcggggccacagccctggggtttgtgctggctccctcatccgccctg
ctgaatctggcgcgcacggggctggccgttccccattcccctgtcattgaacgggatggg
gacggcatggtcagtctgacttcctctacgcccgaggcggagataaagtattccgtcaac
aaggggccggaaaaaacgtaccggaatcccttcaagcttcccgaaggggaagttagggcc
tgggctgcctccatgaagtccggcaaggttccttccacgtctcccggagagaggaaattc
cccctcgtcaaggggcagggcgaatggaaaattctaagcgcttcttcggaagagccggat
accggtttcgcccattttgccattgacgggaatccggatacctattggcatacgtcctat
acgaacggcctgccggggttcccccactccattgccgtggatatgggaaccagaatgaag
tttaccggatttatctacacgcccagaatggacaaggacaagggcctcatcagccagtac
acgttttccgtttccgatgacggtcggaattggagggaagtgaaaaaaggccagttctcc
taccactatatccggaaggatccggctgttcagcgcatcgacttcggcaggcctgtggag
gcccgctactttaagcttgacgcccggtctccggtgaggggcggggaacagagcgccacc
gttgcggagctgaatatcattacccaataa

DBGET integrated database retrieval system