KEGG   Akkermansia muciniphila: Amuc_1671Help
Entry
Amuc_1671         CDS       T00736                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
amu  Akkermansia muciniphila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Amuc_1671
   01230 Biosynthesis of amino acids
    Amuc_1671
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amuc_1671
   00030 Pentose phosphate pathway
    Amuc_1671
   00051 Fructose and mannose metabolism
    Amuc_1671
   00052 Galactose metabolism
    Amuc_1671
  Energy metabolism
   00680 Methane metabolism
    Amuc_1671
Enzymes [BR:amu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Amuc_1671
Protein phosphatases and associated proteins [BR:amu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Amuc_1671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2025088..2026332)
Genome map
AA seq 414 aa AA seqDB search
MNPLKGACIIGQSGGPTAVINASALGAIQSALQSEQVTRVLGAANGIEGVLKERLFDMAR
EDPGELELLKYTPASALGSCRYKMAAPSVDDTDYRRLLEIFRKYDVRYFFYNGGNDSMDT
CNKISKFMQQSGYECRVIGIPKTIDNDLHGTDHCPGFGSAAKFIATSCMEVHQDLRVYDK
GRVTIVEIMGRHAGWLAGSAALATYAGAGPDLVYLPEVPFRMEEFWQDVDRIYRQNGSCM
VAVSEGVQYADGRFVAESGDRDVFGHTQLGGLGAMLAESVKRQTGAKVRSIELSLLQRCA
SHVASKTDIDEAYMAGKAAVEAAVSGQTDKMVAFERITENGIYSCKTKLIGLEEVANVEK
LVPREWINARGNGVEQPFIDYVLPLIQGETAMQKECSLPRFAKLRKVPAKPEQR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaacccattgaaaggagcatgcatcatcggccagtccggcggccccaccgccgtcatc
aacgccagcgcactgggagccattcagtccgccctgcaaagcgaacaggtcacgcgcgtg
ctgggagccgccaacgggattgagggagtgctcaaagaacgcctgttcgatatggcccgg
gaagaccccggagaattggaattgctcaaatataccccagcatctgccctgggttcctgc
cgctacaagatggcagccccgtccgtggatgatacggattaccgccgtctgctggaaatt
ttcagaaaatacgacgtacgctactttttctacaacggaggcaacgattccatggatacc
tgtaacaagatatccaaattcatgcagcagtccggttacgaatgccgcgtcatcggaatt
cccaagaccattgacaatgaccttcacggcacggaccactgccccggcttcggctctgcc
gccaaatttatcgctacctcctgcatggaagttcaccaggacctccgcgtgtacgacaag
ggacgcgtcaccattgtggaaatcatgggccgccacgccggctggctggccggatccgca
gccctggccacgtatgcgggagcaggtccggacctggtttacctgccggaagttcccttc
cgcatggaggaattctggcaggatgtggaccggatttacaggcagaacggcagctgcatg
gtcgccgtctcggaaggcgtgcagtatgcagacggccgctttgttgcggaatccggagac
agggacgtcttcggccatacgcagctgggaggcctgggagccatgcttgcggaatccgtc
aagcgacaaaccggggccaaagtcagaagcattgaactctcactcctccagcgctgcgcc
tcccatgtagcctccaagacggatatcgatgaagcgtatatggcgggaaaagccgccgtg
gaagccgccgtttccggccagacggataaaatggtagcctttgaacgaatcacggagaac
ggcatttattcctgcaagactaaattgataggtctggaagaagtggccaatgtggaaaaa
cttgttccccgcgaatggatcaacgcccgcggcaatggcgtggaacagccgttcattgat
tacgttcttcccctgatccagggagaaacggccatgcaaaaggaatgttccctgccccgc
ttcgcgaaactcaggaaagtgccggcaaagccggaacagcggtag

DBGET integrated database retrieval system