KEGG   Akkermansia muciniphila: Amuc_1686Help
Entry
Amuc_1686         CDS       T00736                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
amu  Akkermansia muciniphila
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Amuc_1686
Enzymes [BR:amu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Amuc_1686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2048214..2050556
Genome map
AA seq 780 aa AA seqDB search
MKLSFFSVLLLAGHLCAAAPMPLPESNDGARHVFSTNQENFLMDGKPVKIISGEMHYPRV
PRQHWKDRFQRIKAMGMNTVCTYLFWNVHEPEPGKWDFSGNLDFVEFIKEAQKAGLWVIV
RPGPYVCAEWEFGGFPGWLLKDEDLKVRSQDPRFLEPAMAYLKKVCSMLEPLQITKGGPI
IMAQVENEYGSYGSDKDYVKKHLDVIRKELPGVVPFTSDGPNDWMIKNGTLPGVVPAMNF
GGGAKGAFANLEKHKGKTPRINGEFWVGWFDHWGKPKNGGSTEGFNRDLKWMLENNVSPN
LFMAHGGTSFGFMNGANWEGAYTPDVTNYDYGAPISENGTLTDRYRTFRQTIQDYYGDTY
KLPEPPAQPEMMELPPITFTETAGMFSRLPQPVIRKEPVHMEALGQSLGFILYRTKVNGP
VKGELKMNNMQDRAIVYVDGKRQGAADRRYKQDSCDIVIPSGLHTVDIFVENMGRINFGG
QIQGERKGIRGPITLDGKKLENFLIYNFPCKGVELIPFSGKKPAGDQPVFHRGYFNVSNP
KDTYLDMRDGWKKGVVWVNGRNLGRFWFIGSQQALYCPGEYLKPGKNEIVVLDVDGGSGT
VKGVKEAIYEVNRDPAMADVFRVGKPVAPAAGQLVHKGSFAKGADQQEIKFRAPVQARYI
AIVSKNAHDNGPHAAIAELNFLDASGNLLPREQWSVVYADSHETTGEAAQAGLVMDNQPT
TYWHTKWQGDNPRHPHMIVLDLGKVQKLSGFRYLPRQDRENGRIKDYEVYASPKPFKPAK
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatcctttttctccgttctgcttctggcagggcatctttgtgcggctgctccc
atgcctttgccggaatccaatgacggagccaggcatgtcttctctactaatcaggaaaat
tttttgatggacggaaagcccgtcaaaatcatttccggggaaatgcattatcctcgcgtg
ccgcgccagcactggaaggacaggttccagcgcataaaggccatgggcatgaataccgtc
tgcacttatctgttctggaacgtgcatgaaccggaacccggcaaatgggacttttccggc
aatctggattttgtggaattcatcaaggaggcgcagaaggccggcctgtgggtcattgtg
cgtcccgggccctatgtgtgcgcggaatgggaattcggcggatttcccggctggctgctg
aaggatgaagatttgaaagtccgttcccaggatccccgcttcctggaaccggccatggct
tatcttaaaaaagtctgttccatgctggaacctctgcagattaccaagggaggccccatc
atcatggcccaggtggaaaatgaatacggctcctatggttctgacaaggattacgtgaaa
aagcatctggacgttatccggaaagaacttccgggagttgttcccttcacgtcggacggc
ccgaacgactggatgatcaagaacggcacgcttccgggcgttgttcccgccatgaatttc
ggcggcggagccaagggcgcttttgcgaatctggagaagcacaagggcaaaacgccccgc
atcaacggcgaattctgggtgggctggtttgaccactggggcaagcccaagaatggcggc
agtacggaaggtttcaaccgagacctgaagtggatgctggaaaataacgtttcccccaac
ctattcatggcgcatggggggacctccttcggcttcatgaacggggcgaactgggaaggc
gcctacacgccggatgtaaccaattacgactacggcgcccccatttccgaaaacggaacc
ctgacggaccgctaccgcaccttccgccagactattcaggattattacggtgatacgtac
aagcttcccgaacctcccgcccagccggaaatgatggagctgcctcccatcacgtttacg
gaaacagccggcatgttctcccgcctgccgcagcccgtcatccgcaaggagcccgtccac
atggaagccttggggcaaagcctgggcttcatcctgtaccggacaaaggtgaacggcccg
gtgaaaggagagctgaagatgaacaacatgcaggaccgcgccatcgtttacgtggacggc
aagaggcagggggcggcggaccgccgttacaagcaggattcctgtgacattgtcattccc
tccggacttcacacggtggacatttttgtggaaaacatgggccgcatcaacttcggcggc
cagatacagggcgagcgcaagggcatccggggccccattacgctggacggcaaaaagctg
gaaaacttccttatctacaacttcccgtgcaagggggtggagcttattcccttctccggc
aagaagccggcgggcgaccagcccgtgttccaccgcgggtatttcaacgtttccaatccc
aaggatacctacttggatatgcgggacggctggaagaaaggcgtcgtgtgggtgaatgga
cgcaatctgggccgcttctggtttatcggctcccagcaggctctttattgccccggagaa
tacctgaagcccgggaaaaatgaaatcgtggtgctggacgtggacggaggttccggcacg
gtgaagggtgtgaaggaagccatttatgaagtcaacagggaccccgccatggcggatgtc
ttccgcgtgggcaaacctgtggcccccgctgccggccagctggtgcacaagggttccttc
gccaagggggcggaccagcaggaaatcaaattccgcgctcctgtccaggcccgttacata
gctattgtcagtaaaaacgctcatgacaacggcccccatgccgccattgcggagctgaac
ttcctggatgcctccggcaatctgctcccccgcgaacagtggtccgtggtttatgcggat
tcccatgaaacgacgggagaagccgcccaggcgggactggtgatggacaaccagcccacc
acctactggcataccaagtggcagggggacaaccccaggcatccgcacatgatcgtgctg
gatctgggcaaggtgcagaaactttcaggattccgctacctgccgcgccaggaccgggaa
aacggccgcatcaaggactatgaagtctatgcgtctcccaagccgttcaagcctgccaag
taa

DBGET integrated database retrieval system