KEGG   Akkermansia muciniphila: Amuc_1692Help
Entry
Amuc_1692         CDS       T00736                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
amu  Akkermansia muciniphila
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Amuc_1692
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Amuc_1692
  Amino acid metabolism
   00310 Lysine degradation
    Amuc_1692
Enzymes [BR:amu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Amuc_1692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2055566..2056657)
Genome map
AA seq 363 aa AA seqDB search
MSDILTPNFGESITSATVAAWHKNAGDPVAKGDTLVTLETDKVSTDLEADESGVLEILVP
EGAEAPIGAVLGRISPLDGSSAAPPSVPLETREKPASGPSSPVTGAPEQKPEKKTSSPDQ
TTSGKNGKTVKEASPRFIRKPMSPLRRTIAARLVEAQHQAAILTTFNECDMSSVMELRKQ
FNAAYRERYGTKLGFMSFFIKAVVKALQEVPQVNARIDGTDIVENLYYDISIAIGTDKGL
VVPVLRDCDRKTLPELELELASLTEKARRGNLSMQNLQGGCFTISNGGTYGSLLSTPILN
PPQSGILGMHAIQERPVVRDGQITARPMMYLALSYDHRLVDGKQAVQFLITVKNAVENPV
FEL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcctgactcccaactttggagaatccatcacctccgccaccgtagccgcg
tggcacaagaatgccggcgacccggtagccaaaggcgacactctggtgacgctggaaacg
gacaaggtttccacggatttggaggcggatgaaagcggcgtgctggaaatcctcgtcccg
gaaggggcggaagcccccatcggcgcggttttaggccgcatttccccccttgacggaagt
tccgccgcaccgccctccgtaccactggaaacgcgggagaaacccgcttccggtccctcc
tcacctgtgactggcgccccggaacaaaagccggaaaagaaaacatcctcaccggatcag
acaacctccggaaaaaatgggaaaacagtaaaggaggcttctccgcgcttcatcagaaaa
cccatgagcccgttgcgccgtaccatcgcggcacggttggtagaggcccagcaccaggcg
gccatcctgactaccttcaacgaatgcgacatgtcctccgtgatggaactccgcaaacaa
ttcaatgcagcgtaccgggaacggtacggaaccaaactcggtttcatgagcttctttatc
aaggccgtagtcaaagcattgcaggaagtgccccaggtcaacgccagaatagacggtacg
gacatcgtggaaaacctgtactatgacatctccatagccatcggcacagataagggtctc
gtcgtccccgtgctgcgggactgcgaccggaaaacgcttccggagctggaactggaactc
gcttccctgacggaaaaagcacgcaggggaaacctgtccatgcagaatctgcaaggcggc
tgcttcaccatctccaacggcggaacatatgggtcgcttctttccacgcccatcctgaac
ccgccccagagcggcattctgggcatgcatgccatccaggaacgccccgtggtccgggac
ggccaaatcaccgcccggcccatgatgtacctggccctttcctacgaccaccgcctggtg
gacggcaagcaggccgtgcaattcctcattaccgtaaaaaatgccgtggaaaacccggtg
ttcgagctgtga

DBGET integrated database retrieval system