KEGG   Akkermansia muciniphila: Amuc_1700Help
Entry
Amuc_1700         CDS       T00736                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
amu  Akkermansia muciniphila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Amuc_1700
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Amuc_1700
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Amuc_1700
Enzymes [BR:amu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Amuc_1700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2065567..2066790)
Genome map
AA seq 407 aa AA seqDB search
MDLHTYLRNFPDAQGRFGEYGGVYLPDELVPAFEEITEAYQTIAHSAQFINELRRIRKQF
QGRPTPVYHCERLSRHLGTSQIYLKREDLNHTGAHKLNHCMGEGLLAKYMGKKRIIAETG
AGQHGVALATAAAFFGLECEIHMGAVDIAKQAPNVTRMKILGAKVVPVTHGLQSLKEAVD
SAFESYLNSYQDSIYCIGSVVGPHPFPQMVRDFQMCIGVEAREQFLEMTGLLPDAVCACV
GGGSNSMGMFTAFLGDPLDIYGVEPLGKGPRLGDHSASITYGRKGVLHGFESIMLQDEDG
NPGPVHSVASGLDYPSVGPEHAYLHDIGRVNYVTATDEEAVDAFFKLSRYEGIIPALESS
HAIAYAMKWARENRGGAILVNCSGRGDKDVDYVVEHYGYGEDHQFPA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggatctccatacttatttacgcaattttccagacgcccagggccgttttggcgaatac
ggcggcgtttacctgccggacgagctggttcccgcttttgaagaaattacggaagcctac
cagacgatagcccactccgcccagttcattaatgaattgcggcgcatccgcaaacagttt
cagggacgtcccaccccagtttaccactgcgaacgcctttcccgccacctgggcacctct
caaatttacctgaagagggaagatttgaaccatacaggcgcccataagctcaaccattgc
atgggggaaggccttctggccaaatacatgggcaagaagcgcattatcgcggaaacgggc
gcaggacagcatggcgtggcgctggctacagccgccgccttcttcggcctggaatgcgaa
attcacatgggagcggtagatattgccaagcaggctccgaatgtcacccgcatgaaaatc
ctgggtgccaaggtggttcctgtcacgcacggcctccaaagcttgaaggaagctgtggat
tccgcctttgaatcttacctgaacagttatcaggattccatttactgcatcggttccgtg
gtaggcccccaccctttcccgcaaatggtgcgcgatttccaaatgtgcatcggcgtggaa
gcccgggaacaattcctggaaatgacgggacttctgccggacgccgtctgcgcctgcgtg
ggcggcggcagcaattccatgggcatgtttaccgccttcctgggagacccgctggatatc
tatggcgtagaacccctcggcaaaggtcccaggcttggggatcattccgcctccatcacc
tatggacgcaagggcgtcctgcacggttttgaaagcatcatgctccaggatgaagacggt
aatccgggaccggttcattccgtagccagcggcctggattatccttccgtagggccggaa
cacgcctatctgcacgacatcggccgcgttaactatgtcaccgccacagacgaggaagcc
gtggacgccttcttcaaactttcccgttacgaggggatcattcccgctctggaaagctcc
cacgctatcgcgtatgccatgaagtgggcacgggaaaacagaggaggcgccattctggta
aactgctccggccgcggagacaaggatgtggattacgtcgtggagcattacggctatggg
gaagaccaccagttccccgcctga

DBGET integrated database retrieval system