KEGG   Akkermansia muciniphila: Amuc_1714Help
Entry
Amuc_1714         CDS       T00736                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
amu  Akkermansia muciniphila
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Amuc_1714
  Amino acid metabolism
   00340 Histidine metabolism
    Amuc_1714
Enzymes [BR:amu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Amuc_1714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2082977..2084275
Genome map
AA seq 432 aa AA seqDB search
MKIYRPSDTCFDEMKRRMNRRALPEDSVRDTVNAIIRDVSVRGDEALFDYAARFDKAHLD
SSSLFVTEAELAEAEAMVEESVKEAIAVSLANIHYFSDRSRRRDWSGVNAQGVEVAERFL
PYDRVGIYIPGGKAPLVSTSIMTGGFAQAAGVREIVAATPCGPDGRVNPALLYALKASGA
TEIVKIGGAQAIAALALGTESVRPVEKIFGPGNRFVVEAKRQLVGAVAIDLLPGPSEVMV
LADDTADAEFLAADLLAQGEHGPDSVVVFVTTSKALLEQVEAEVERQAALLSRGSIIREV
LDKHAYGFLVSSIQEGVELVNAFAPEHLVLVTRDEEAVLNGIRTAGAIYAGSLSTVACGD
FLAGPSHTLPTGGAGKSFSGLRADQFQRRTSVVRMDRNAVLNSAPYVAEFARVEGLDAHN
HSIQVRAARVDR
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttaccgtccttccgatacctgctttgacgagatgaagcgccggatgaaccgc
cgcgcactcccggaggattccgtaagggataccgtgaacgctattatccgggatgtttcc
gtgcgcggagatgaagccctgtttgattatgccgccagatttgacaaggcgcatctggat
tcttcctccctgttcgtaacggaggcagaactggcggaagcggaggccatggtggaggag
tctgtgaaggaggccattgccgtttctctggcaaacatccattatttttcagaccgcagc
cgcaggcgggactggtccggcgtgaatgcgcagggcgtggaggtagcggagcggttcctt
ccgtacgaccgtgtgggcatttatatccccggaggaaaggctcccctggtatctacttcc
atcatgacgggcggttttgctcaggccgccggcgtgcgggagattgtggccgccacgccc
tgcgggccggacggccgggtgaatcccgcgcttttgtatgcgctgaaagcctccggcgca
acggagattgtcaagatagggggagcccaggcgatagccgcccttgcgctggggacggag
agcgtgagaccggtggagaagatttttggccccggcaaccgttttgtggtggaggccaag
cgtcagttggtgggggccgttgccattgatttgctgcccggccccagtgaagtaatggtg
ctggcagatgatactgcggatgcggagttccttgctgccgacctgctggcgcagggcgag
catggcccggacagcgtagttgtttttgtcaccacatcgaaagcgttattggagcaggtg
gaggcggaagtggaacgccaggccgccctgctgagccgcgggtccatcatccgggaggtg
ctggacaagcatgcctacggttttctggtttcttccattcaggaaggggtggaactggtt
aatgcttttgcgccggaacatttggtgctcgtcacgagggatgaagaagccgtgctgaat
ggcatcaggacggcgggagccatttacgcaggctccctttctactgtagcctgcggggat
tttctggcgggtcccagccatacgctgcctaccggcggcgccggcaagtctttttccggc
ttgcgggcggatcagttccagcgccgcaccagcgtggtgcgcatggaccggaatgccgtg
ctgaactccgccccgtatgtggcagagttcgcccgggtggaggggctggacgcccacaac
cactccattcaggttcgcgccgcccgtgtggaccggtaa

DBGET integrated database retrieval system