KEGG   Akkermansia muciniphila: Amuc_1714Help
Entry
Amuc_1714         CDS       T00736                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
amu  Akkermansia muciniphila
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:amu01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:amu00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2082977..2084275
Genome map
AA seq 432 aa AA seqDB search
MKIYRPSDTCFDEMKRRMNRRALPEDSVRDTVNAIIRDVSVRGDEALFDYAARFDKAHLD
SSSLFVTEAELAEAEAMVEESVKEAIAVSLANIHYFSDRSRRRDWSGVNAQGVEVAERFL
PYDRVGIYIPGGKAPLVSTSIMTGGFAQAAGVREIVAATPCGPDGRVNPALLYALKASGA
TEIVKIGGAQAIAALALGTESVRPVEKIFGPGNRFVVEAKRQLVGAVAIDLLPGPSEVMV
LADDTADAEFLAADLLAQGEHGPDSVVVFVTTSKALLEQVEAEVERQAALLSRGSIIREV
LDKHAYGFLVSSIQEGVELVNAFAPEHLVLVTRDEEAVLNGIRTAGAIYAGSLSTVACGD
FLAGPSHTLPTGGAGKSFSGLRADQFQRRTSVVRMDRNAVLNSAPYVAEFARVEGLDAHN
HSIQVRAARVDR
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttaccgtccttccgatacctgctttgacgagatgaagcgccggatgaaccgc
cgcgcactcccggaggattccgtaagggataccgtgaacgctattatccgggatgtttcc
gtgcgcggagatgaagccctgtttgattatgccgccagatttgacaaggcgcatctggat
tcttcctccctgttcgtaacggaggcagaactggcggaagcggaggccatggtggaggag
tctgtgaaggaggccattgccgtttctctggcaaacatccattatttttcagaccgcagc
cgcaggcgggactggtccggcgtgaatgcgcagggcgtggaggtagcggagcggttcctt
ccgtacgaccgtgtgggcatttatatccccggaggaaaggctcccctggtatctacttcc
atcatgacgggcggttttgctcaggccgccggcgtgcgggagattgtggccgccacgccc
tgcgggccggacggccgggtgaatcccgcgcttttgtatgcgctgaaagcctccggcgca
acggagattgtcaagatagggggagcccaggcgatagccgcccttgcgctggggacggag
agcgtgagaccggtggagaagatttttggccccggcaaccgttttgtggtggaggccaag
cgtcagttggtgggggccgttgccattgatttgctgcccggccccagtgaagtaatggtg
ctggcagatgatactgcggatgcggagttccttgctgccgacctgctggcgcagggcgag
catggcccggacagcgtagttgtttttgtcaccacatcgaaagcgttattggagcaggtg
gaggcggaagtggaacgccaggccgccctgctgagccgcgggtccatcatccgggaggtg
ctggacaagcatgcctacggttttctggtttcttccattcaggaaggggtggaactggtt
aatgcttttgcgccggaacatttggtgctcgtcacgagggatgaagaagccgtgctgaat
ggcatcaggacggcgggagccatttacgcaggctccctttctactgtagcctgcggggat
tttctggcgggtcccagccatacgctgcctaccggcggcgccggcaagtctttttccggc
ttgcgggcggatcagttccagcgccgcaccagcgtggtgcgcatggaccggaatgccgtg
ctgaactccgccccgtatgtggcagagttcgcccgggtggaggggctggacgcccacaac
cactccattcaggttcgcgccgcccgtgtggaccggtaa

DBGET integrated database retrieval system