KEGG   Akkermansia muciniphila: Amuc_1741Help
Entry
Amuc_1741         CDS       T00736                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
amu  Akkermansia muciniphila
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Amuc_1741
   00052 Galactose metabolism
    Amuc_1741
   00500 Starch and sucrose metabolism
    Amuc_1741
   00520 Amino sugar and nucleotide sugar metabolism
    Amuc_1741
Enzymes [BR:amu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Amuc_1741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2121618..2123003)
Genome map
AA seq 461 aa AA seqDB search
MSTFTPFAEKMESAGVSAAAVNAFSRCYEALVSNHSGMIPETDILPADQVEDWQDITAST
PAADKDLISRCVCIKLNGGLGTSMGLQKAKSLLKVKGEDTFLDLIVRQVKHLRSISGTPV
RLLLMNSFSTSADTLAYLEKYAADGFADRAEVELLQNRVPKILADGLSPASCPEQPELEW
CPPGHGDLYPALLGSGWLDRLLEDGVKYAFVSNSDNLGAQLDMNFLRWFAESGAPFVMEV
TRRTVADRKGGHLAVRKSDGQLILREVAQCPDEDIPEFQNISRHRYFNTNTLWIRLDALK
EILDANGGVLPLPMIRNKKTLNPRDPESAPVYQLETAMGAGIECFPGARAVNVPRSRFFP
VKTTSDLFLLRSDAIAVDEHGNVALAPERQGNTPVVDLDSKLYKLVDSLDGLGLPSLIGM
DKLTLRGRFHFQDGAVLRGTLLMENDSDETKEILPGVYAGA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgttcactccttttgcggaaaagatggagtccgccggcgtttcagccgcggcc
gtcaacgctttctcccgttgttatgaagcccttgtttccaaccactccggcatgattccg
gaaacggacatcctgcccgccgaccaggtggaagactggcaggacatcacggcctccacc
cccgcggcggacaaggacctgatttcccgttgcgtatgcatcaagctcaacggcggcctc
ggcacgagcatgggcctccagaaagcgaaaagcctgctgaaagtaaaaggagaggatacg
ttcctggatttgatcgtcaggcaggtgaagcatctgcgctccatctccggcacgcctgtg
cgccttctgctgatgaactctttctccaccagcgcggacacgctggcctacctggaaaaa
tacgcggcggacggctttgcggaccgcgccgaagtggagctgctgcaaaaccgcgttccc
aaaatcctggcggacggcctctccccggccagctgcccggaacagccggagctggaatgg
tgcccgccaggccatggggacctgtatccggccctgctggggtccggctggctggaccgc
ctgctggaggatggcgttaaatacgcttttgtctccaattccgacaatctgggcgcccag
cttgacatgaacttcctccgctggtttgcggaaagcggcgcccccttcgtcatggaagtc
acccgccgcacggtggcggacaggaaaggcggccacctggctgtcaggaaatcggacggc
cagttgattctgcgggaagtggcccagtgcccggatgaggacattcctgaattccagaac
atttccaggcaccgctatttcaacaccaatacgctctggatacgcctggacgccctcaag
gaaattctggacgccaacggcggcgtactcccgctgcccatgatccgtaataaaaagacg
ctcaacccccgcgatccggaatccgccccggtgtaccagctggaaacggccatgggcgcg
ggcatcgaatgcttccccggcgccagggccgtcaacgtcccgcgttcccgtttcttcccc
gtcaaaaccacttccgacctgttcctgctccgttcggacgccatcgccgtggatgaacac
ggcaacgtggccctggcgccggaacggcagggcaacaccccggtggtggacctggattcc
aaactgtacaagctggtggattccctggacgggctgggcctgccctccctgataggcatg
gacaagctgaccctgcgcggccgcttccacttccaggacggagccgttctccggggcacc
ttgctgatggaaaacgactccgacgaaacgaaggaaatcctcccgggcgtctatgccgga
gcctga

DBGET integrated database retrieval system