KEGG   Akkermansia muciniphila: Amuc_1751Help
Entry
Amuc_1751         CDS       T00736                                 

Definition
glycoside hydrolase family 13
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
amu  Akkermansia muciniphila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Amuc_1751
Enzymes [BR:amu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Amuc_1751
Exosome [BR:amu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Amuc_1751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2132696..2134732
Genome map
AA seq 678 aa AA seqDB search
MRRPPIPGLVMADGWLQPYSRQIRDRQRLFDLKMKRINQRAGSLEEYARGYRYYGFNRDA
ETGAWTYREWAPAARRVSLIGDFNGWNRESHPLERNERGVWEITLPPDALAHGQKVKVHV
VGADGTGRDRIPAWITRTVQDPTTYDFAGEIWMPEHPYEWRNNGFDPSRVEVPFVYEAHV
GMGGEEGRVHTYREFADEVLPRIARLGYNTVQLMAIQEHPYYGSFGYHVSSFFAPSSRFG
EPEDLKYLIDQAHGLGIAVLLDVVHSHAVKNEAEGLNNFDGSGGMYFLPGERGRHPDWDS
CCFDYGRDEVIEFLLSNVRWWLEEFRFDGFRFDGVTSMLYFHRGHEPFGDLGAYFGSSVD
LDAVAYLQLAATLIQRVKPGAIAIAEDMSGMPGLCRPVDEGGIGFSHRLAMGIPDYWIKL
LKEKKDEEWSMGDMWHTLTNRRYGEPHVAYCESHDQALVGDKTLAFRLMDAEMYWKMAVD
QQSLIIDRGMALHKMIRLVTLATGGEGWLNFMGNEFGHPEWIDFPREGNGWSYEYCRRQW
SLVDNPSLRFKFLNAFDQAMVRLAQEARLLNNPPPFPLNIDETNHVMAFHRGGLLFVFNW
SGDRAIMDYMLPVPQKGEWRVVLDTDNARFGGFGRQDVSMPHFTDGEGNLSLYLLPRTAL
VLKRVGSAVMARHPGRED
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgagaagacccccgatacccggcttggtgatggcggacggatggctccagccgtattcc
cgccagatacgcgaccgccagcgtctgtttgacctgaaaatgaagaggatcaatcagcgc
gccggctctctggaggaatacgcgcgcggataccgctattacggtttcaacagagacgcg
gagacgggggcgtggacataccgggaatgggctcccgccgcccgcagggtgtccctgatt
ggggattttaacggctggaaccgggagagccacccgctggagcggaatgagcgcggcgtg
tgggaaattacgctgccgcctgatgcgctggcccacgggcagaaggtgaaggtgcacgtg
gtcggtgcggacggcacgggcagagatcgcattcccgcatggattaccaggaccgtccag
gatccgaccacttatgattttgccggggagatctggatgccggaacacccctatgaatgg
cggaataacggttttgatccctcccgggtggaagttccgttcgtgtatgaagcgcatgta
ggcatgggcggggaagaagggcgcgtgcatacgtaccgcgagtttgcggacgaggttctc
ccccggatcgccaggctgggttacaataccgtccagctgatggcgatccaggagcacccc
tattacggttccttcggctaccacgtttcttcctttttcgccccttcctcccgtttcggc
gagccggaggacctgaagtacctgatagaccaggcgcacggcctgggcatcgccgtgctg
ctggacgtggtgcattcccacgccgtgaagaacgaggcggaagggctgaacaattttgac
ggttccggaggcatgtatttcctgcccggggagcgcggccgccatccggactgggattcc
tgttgttttgattatggccgggacgaggtgattgaattcctcctgtccaatgtccgctgg
tggctggaagagttccgttttgacggcttccgttttgacggcgtgacatctatgctgtat
ttccaccgcgggcatgagccgttcggggatttgggcgcctacttcggctcttccgtggat
ctggatgccgtggcttatctgcagctggccgccacgctgattcagcgggtgaagccgggc
gccatagcgattgctgaggacatgtccggcatgccgggattgtgccgcccggtggacgaa
ggggggattggtttttcccaccgtctggccatgggcattcccgattactggattaagctg
ctcaaggagaaaaaggatgaggaatggagcatgggcgatatgtggcacacgctgaccaac
aggcgctacggcgagccgcatgtggcctattgcgagagccatgaccaggccctggtgggg
gacaagactctggcgttccgcctgatggatgcggaaatgtactggaaaatggccgtggac
cagcagagcctcattattgaccgcggcatggcgctgcacaagatgatccgcctggtgacg
ttggctaccgggggggaaggctggctgaatttcatgggcaacgaattcgggcatccggaa
tggattgattttccgcgcgaaggcaacggctggtcttacgaatactgccgccgccagtgg
tccctggtggacaatccttccctcaggttcaagttcctgaatgcctttgaccaggcgatg
gtccgcctggcgcaggaagcccgcctgctgaataatccgccgcctttcccgcttaatatt
gacgagaccaaccatgtcatggcattccaccgcggcggtctgttgtttgtgttcaactgg
tccggagacagggctatcatggattacatgctgcccgttccccagaagggggaatggcgg
gtagtgctggatacggacaacgcccgtttcggcggtttcgggaggcaggatgtttccatg
ccgcattttacggatggggaggggaatctttccctgtacctgctgccgcgtacggccctg
gtcctgaagagggtaggttccgccgtcatggcccgccacccggggcgggaggattag

DBGET integrated database retrieval system