KEGG   Akkermansia muciniphila: Amuc_1911Help
Entry
Amuc_1911         CDS       T00736                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
amu  Akkermansia muciniphila
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Amuc_1911
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amuc_1911
  Lipid metabolism
   00071 Fatty acid degradation
    Amuc_1911
  Amino acid metabolism
   00350 Tyrosine metabolism
    Amuc_1911
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Amuc_1911
   00626 Naphthalene degradation
    Amuc_1911
Enzymes [BR:amu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Amuc_1911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2317939..2319099
Genome map
AA seq 386 aa AA seqDB search
MYQPFQFFMPAQIFFGAGSLDNLGSAPLPGTKALIVIGGSSVKRLGYLDRVQALLKKQGV
ESVVFDKVQPNPVVEHVMEASSLARETGCDFVIGLGGGSSMDSAKSIAVMAANPGTYWDY
IQGGSGKGLPIPCKPLPIVCITTTAGTGTEADPWTVITKEDTQEKIGFGFKGTFPTMSIV
DPELMLSVPPKLTAYQGFDALFHAVEGYMATIASPMGDMFALQAIEYIAKYLPRAVNNGD
DLEARAYVALANTYSGFVETISCCTSEHSIEHALSAFHPSLPHGAGLIMISWAYHEAYAP
SCPERYARVAAAMGQEASVDGFLNGLNSLKEACGVDKLKMSEFGITPDLFDEYAKTAFST
MGNLFELDRCKLTPADVVSILEKSYS
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtatcagccatttcaatttttcatgcccgcgcaaatcttttttggcgcgggttctttg
gacaatcttggttccgctcccctgcccggcaccaaggccctgatcgtcatcggcgggtcg
tccgtcaaacgcctcgggtatctggaccgcgtacaggctcttctgaaaaaacagggagtg
gaaagcgttgttttcgataaagtgcagcccaaccccgtggtggagcacgtaatggaagcc
tcctccctggccagggaaacgggctgtgatttcgtcatcggcctgggcgggggcagcagc
atggattccgccaagagcatcgccgtgatggcggccaatccaggaacctactgggattac
atccagggaggttccggcaaggggcttcccattccctgcaaacctcttcccatcgtctgc
atcaccactacggcgggaaccggaacggaggcggatccgtggaccgtcatcacgaaagag
gacacgcaggagaagatcggtttcgggttcaagggtactttccccaccatgtctatcgta
gatccggagttgatgctttccgtacctcccaaattaacggcataccaggggtttgacgct
ttgttccatgccgtggagggatatatggctacaatcgcctcccccatgggggacatgttc
gcgctccaggctattgaatacattgccaaatatcttccgcgcgccgtaaataacggggat
gatctggaagcgcgcgcctatgtggcgctggccaatacctattccgggtttgtggaaacc
atttcctgctgtacgtcggaacattccattgaacatgccctcagcgccttccatccttcc
ctgccccatggcgcggggctaattatgatttcctgggcctaccatgaagcctatgctccc
tcctgcccggaacgttacgcaagagttgccgcagccatgggacaggaagcctccgtggac
ggtttcctgaacggcttgaacagcctgaaggaagcctgcggcgtagacaagctgaagatg
tccgaattcggcattacaccggatttatttgacgaatacgccaaaacggctttttccacc
atgggcaatctgtttgagctggaccgttgcaagttgactccggcggacgtggtcagcatc
ctggagaaatcctattcctag

DBGET integrated database retrieval system