KEGG   Akkermansia muciniphila: Amuc_2031Help
Entry
Amuc_2031         CDS       T00736                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
amu  Akkermansia muciniphila
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Amuc_2031
   00670 One carbon pool by folate
    Amuc_2031
Enzymes [BR:amu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Amuc_2031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2466797..2467276)
Genome map
AA seq 159 aa AA seqDB search
MSQPVTYTGVVAMAPDRGIGYRGALPWHLPDDLKTFKRITTGHPVLMGRKTYESIGRPLP
GRQNIVLTRDPAWTAEGVQVVHSAGELECLELMDPEIMVIGGAEIFSLMMPAMSRMWVSK
VKGEYPADTFLPPFENRLERAVLKEHFEDFDLYLYEQVK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacccgttacttatacaggagtggtcgccatggctcccgaccgcggcattggt
taccggggggcgctcccctggcatttgccggacgacctcaagacgttcaagcgcattacg
acggggcaccccgtgctgatgggccggaaaacgtatgagagcataggcaggcctcttccc
ggcaggcagaacatcgtgctgacccgtgacccggcgtggacggcggaaggcgttcaggtg
gttcattccgcaggggagttggaatgtctggaattgatggacccggaaatcatggtgatc
gggggtgcggagattttttccctgatgatgccggccatgtcccgcatgtgggtttccaaa
gtaaagggggaatatccggcggatacttttcttcctccgtttgagaaccggctggagcgt
gccgtcctgaaggaacattttgaagattttgacctgtatttgtacgagcaggtcaaatag

DBGET integrated database retrieval system