KEGG   Acidiphilium multivorum: ACMV_01520Help
Entry
ACMV_01520        CDS       T01446                                 

Gene name
hemD
Definition
putative uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
amv  Acidiphilium multivorum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ACMV_01520 (hemD)
Enzymes [BR:amv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ACMV_01520 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(170353..171132)
Genome map
AA seq 259 aa AA seqDB search
MQRDWGRNSVPRCGATARPTSFLTDTGATEPLTVLVTRPEPGGSATAAALRAAGYVPVLA
PCLEIEPLPGALPTLVDGIVIASTQALPGLPPALRAVPLFAVGDATAARARAAGFIDVAS
AAGTARELAALLGERLAPGARLLLACGAGHSMDLAADLRGRGFRVTRRVVYRSRPARQLD
AAAQAALEAGEIDRVMVFSPASARRFVTLITEAGLDGALAGAIAVAISPAAAAPLTRLPF
RDIRSAVSPDQDHMITILA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcgactgggggcggaactcggtgcctcgctgcggcgcgacagcccggccgaca
tctttcttgactgacaccggtgcgacagagccgctcaccgtcctggtgacgcgccccgaa
ccgggcggcagcgccaccgccgccgccctccgcgcggcaggatatgtgccggttctcgcg
ccctgtcttgagatcgaaccattgccgggggctttgccgacgctggtggatggaatcgtg
atcgccagcacccaggcgctgcccggcctgccaccggcactgcgggccgtgccgctgttc
gcggtgggtgatgccaccgccgcccgcgcgcgggcagccgggttcatcgacgtcgcgagt
gccgccggaacggcacgggaactggcggcgctgttgggtgagcggctcgctcccggcgca
cggctgctgctggcctgtggtgcagggcacagcatggatctcgctgctgatcttcgcggc
cgcggcttccgggtgacacgtcgggtggtgtaccgctcgcgcccggcccggcagctcgac
gcggcagcccaggcggcgctggaggcaggcgaaatcgaccgggtgatggtattctcacca
gccagcgcgcggcgtttcgtgaccctcatcactgaggcggggctcgacggggcgctggcc
ggggcgattgccgtggcaatcagcccggcggctgcggccccgctcacgcgcctgcccttc
cgcgacatccgcagcgcggtttcgcccgatcaggatcacatgataacgatactggcatga

DBGET integrated database retrieval system