KEGG   Acidiphilium multivorum: ACMV_02600Help
Entry
ACMV_02600        CDS       T01446                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
amv  Acidiphilium multivorum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:amv01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:amv00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
303500..304651
Genome map
AA seq 383 aa AA seqDB search
MSPGLPDPGSARLLVVKIGSALIVDPDAAAPRTAWLASVAADIAALRARGVGVIVVSSGA
IALARRQLGLTQKRLRLEEKQAAASVGQIRLAQAWSEALSAHGLVAAQLLLTMDDTEDRR
RYLNARATLRTLLELGAVPVINENDSVATGEIRFGDNDRLAGRVAEMVEADQLVLLSDID
GLYTADPRRDSAAAHLPVVAAITPEIEAMGGAPPPGYSSGGMRTKLVAARIATQAGCAMA
IALGGVAHPLASLEAGARCTWFLPQPGGRSARKRWIAGSLAPLGRLHVDAGAARAIRRGS
SLLPAGVVRVEGRFERGDAVEIAGPDGAALARGLAAYPSEDAMLIAGHRTDEIEALLGWR
GRDELIHRDDLVLVAGPLPSVSS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagcccggggctgcccgatccaggcagcgcacggctgctggtggtgaagatcgggtcc
gccctcatcgtcgatcccgatgccgcggcgccgcgcacagcctggcttgcaagcgtggcc
gccgacatcgcggccctccgggcgcgcggcgtcggtgttatcgtggtgtcctccggggcg
atcgctctcgcgcggcggcagcttggcctgacgcagaagcggctgcgactcgaggaaaag
caggccgcggcctcggtggggcagatccggctggcgcaggcctggagcgaggcgctttcg
gcgcacgggctggtcgcggcgcaactgttgctgaccatggacgataccgaggaccggcgg
cgctatctcaacgcgcgggccacgctccgcacgctgctcgaactcggcgccgtgcctgtg
atcaacgagaacgactcggtcgccaccggcgagatccgcttcggcgacaacgaccggctc
gccggtcgggtggccgaaatggtggaggccgaccaactggtcctgctctccgatatcgac
gggctctataccgccgatccgcggcgcgactcggcggcggcgcatctacctgtcgtcgcc
gcgatcacgccggagatcgaggcgatgggcggcgcgccgccgccgggctattcctccggc
gggatgcggaccaaactcgtcgccgcgcggatcgcgacccaggccggctgtgccatggcg
atcgcgcttggcggggttgcgcatccgctcgcgtccctcgaagcgggggcgcgctgcacc
tggttcctgccgcagcccggcgggcgctcggcgcgcaagcgctggatcgccggctcgctc
gcgccgctcgggcggctgcatgttgacgccggcgcggcgcgggcgatccgccgcggctca
tcgctgctgccggcaggggtggtgcgcgtcgagggacggttcgagcgtggcgatgcggtc
gagatcgccgggccggatggggcggcgctggcccgcggccttgctgcctatccgagcgag
gatgcgatgctcatcgccggccacaggaccgacgagatcgaggcgctgctcggctggcgc
ggtcgggatgaactgatccaccgcgacgacctcgtgctcgtcgccggcccgttgccgtcc
gtttcgtcgtag

DBGET integrated database retrieval system