KEGG   Acidiphilium multivorum: ACMV_02600Help
Entry
ACMV_02600        CDS       T01446                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
amv  Acidiphilium multivorum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ACMV_02600 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ACMV_02600 (proB)
Enzymes [BR:amv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ACMV_02600 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
303500..304651
Genome map
AA seq 383 aa AA seqDB search
MSPGLPDPGSARLLVVKIGSALIVDPDAAAPRTAWLASVAADIAALRARGVGVIVVSSGA
IALARRQLGLTQKRLRLEEKQAAASVGQIRLAQAWSEALSAHGLVAAQLLLTMDDTEDRR
RYLNARATLRTLLELGAVPVINENDSVATGEIRFGDNDRLAGRVAEMVEADQLVLLSDID
GLYTADPRRDSAAAHLPVVAAITPEIEAMGGAPPPGYSSGGMRTKLVAARIATQAGCAMA
IALGGVAHPLASLEAGARCTWFLPQPGGRSARKRWIAGSLAPLGRLHVDAGAARAIRRGS
SLLPAGVVRVEGRFERGDAVEIAGPDGAALARGLAAYPSEDAMLIAGHRTDEIEALLGWR
GRDELIHRDDLVLVAGPLPSVSS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagcccggggctgcccgatccaggcagcgcacggctgctggtggtgaagatcgggtcc
gccctcatcgtcgatcccgatgccgcggcgccgcgcacagcctggcttgcaagcgtggcc
gccgacatcgcggccctccgggcgcgcggcgtcggtgttatcgtggtgtcctccggggcg
atcgctctcgcgcggcggcagcttggcctgacgcagaagcggctgcgactcgaggaaaag
caggccgcggcctcggtggggcagatccggctggcgcaggcctggagcgaggcgctttcg
gcgcacgggctggtcgcggcgcaactgttgctgaccatggacgataccgaggaccggcgg
cgctatctcaacgcgcgggccacgctccgcacgctgctcgaactcggcgccgtgcctgtg
atcaacgagaacgactcggtcgccaccggcgagatccgcttcggcgacaacgaccggctc
gccggtcgggtggccgaaatggtggaggccgaccaactggtcctgctctccgatatcgac
gggctctataccgccgatccgcggcgcgactcggcggcggcgcatctacctgtcgtcgcc
gcgatcacgccggagatcgaggcgatgggcggcgcgccgccgccgggctattcctccggc
gggatgcggaccaaactcgtcgccgcgcggatcgcgacccaggccggctgtgccatggcg
atcgcgcttggcggggttgcgcatccgctcgcgtccctcgaagcgggggcgcgctgcacc
tggttcctgccgcagcccggcgggcgctcggcgcgcaagcgctggatcgccggctcgctc
gcgccgctcgggcggctgcatgttgacgccggcgcggcgcgggcgatccgccgcggctca
tcgctgctgccggcaggggtggtgcgcgtcgagggacggttcgagcgtggcgatgcggtc
gagatcgccgggccggatggggcggcgctggcccgcggccttgctgcctatccgagcgag
gatgcgatgctcatcgccggccacaggaccgacgagatcgaggcgctgctcggctggcgc
ggtcgggatgaactgatccaccgcgacgacctcgtgctcgtcgccggcccgttgccgtcc
gtttcgtcgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system