KEGG   Acidiphilium multivorum: ACMV_02870Help
Entry
ACMV_02870        CDS       T01446                                 

Definition
putative 2-nitropropane dioxygenase (EC:1.13.12.16)
Orthology
K00459  
nitronate monooxygenase [EC:1.13.12.16]
Organism
amv  Acidiphilium multivorum
Pathway
Nitrogen metabolism
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:amv00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
332905..333861
Genome map
AA seq 318 aa AA seqDB search
MSAAQDLRNRLAIPVIGSPLFIISNPKLVIAQCIAGIVGSFPALNARPASQLDEWLAEIT
ETLAAWDRDHPDRKAAPFAVNQIVHRSNARLEQDLELCVKYRAPLVITSLGARPEVNQAV
HGYGGIVLHDIINDRFARKAVEKGADGLIAVAAGAGGHAGTLSPFALVQEIRTWFQGPLA
LSGAIATGRAVLAAEAMGADFAYIGSAFIATEEANAASAYKQAIVASGAEDIVYTNLFTG
VHGNYLRPSIVAAGLDPDNLPQSDASAMNFHEGAKAKAWKDIWGSGQGIGAVDAVLPAGE
RVARLIAEYRAARAALCG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgcacaggatcttcgaaacaggctggcgattccggtgatcgggtcgccgctt
ttcatcatctccaacccgaaactggtcatcgcccagtgcatcgccggcatcgtcggctcg
tttccggcgctgaacgcccggccggcctcccaactcgacgaatggctggcggaaatcacc
gaaaccctggcggcgtgggaccgcgatcatccggaccgcaaggcggcgccgttcgcggtc
aaccagatcgtgcaccgttccaacgcgcggctcgaacaggatctcgaactctgcgtgaaa
taccgcgcgccgctggtcatcacctcgctcggcgcgcggccggaggtgaaccaggcggtg
catggctatggcggcatcgtgctgcatgacatcatcaacgaccgcttcgcccgcaaggcg
gtcgagaaaggggcggacgggttgatcgccgtggccgccggcgccggcggccatgccggc
acgctctcgcccttcgcgctggtgcaggaaatccgcacctggttccaggggccgctcgct
ctgtccggcgcgatcgcgaccggccgcgccgtgctcgccgccgaggcgatgggggccgat
ttcgcctatatcggctcggccttcatcgccaccgaggaggccaacgcggccagtgcctac
aagcaggcgatcgtcgccagcggcgcggaagacatcgtctacaccaatctcttcaccggc
gtgcatggcaactacctgcgcccgagcatcgtcgccgccggcctcgatcccgacaacctg
ccgcagagcgatgcctcggcgatgaatttccacgagggcgcgaaggccaaggcgtggaag
gacatctggggctcggggcaggggatcggcgcggtcgatgccgtgctgccggcaggcgag
cgggtcgcgcggctgatcgccgaataccgcgcggcgcgcgccgccctgtgcggctga

DBGET integrated database retrieval system