KEGG   Acidiphilium multivorum: ACMV_02870Help
Entry
ACMV_02870        CDS       T01446                                 

Definition
putative 2-nitropropane dioxygenase (EC:1.13.12.16)
Orthology
K00459  
nitronate monooxygenase [EC:1.13.12.16]
Organism
amv  Acidiphilium multivorum
Pathway
Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    ACMV_02870
Enzymes [BR:amv01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.12  With incorporation of one atom of oxygen (internal monooxygenases or internal mixed-function oxidases)
    1.13.12.16  nitronate monooxygenase
     ACMV_02870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
332905..333861
Genome map
AA seq 318 aa AA seqDB search
MSAAQDLRNRLAIPVIGSPLFIISNPKLVIAQCIAGIVGSFPALNARPASQLDEWLAEIT
ETLAAWDRDHPDRKAAPFAVNQIVHRSNARLEQDLELCVKYRAPLVITSLGARPEVNQAV
HGYGGIVLHDIINDRFARKAVEKGADGLIAVAAGAGGHAGTLSPFALVQEIRTWFQGPLA
LSGAIATGRAVLAAEAMGADFAYIGSAFIATEEANAASAYKQAIVASGAEDIVYTNLFTG
VHGNYLRPSIVAAGLDPDNLPQSDASAMNFHEGAKAKAWKDIWGSGQGIGAVDAVLPAGE
RVARLIAEYRAARAALCG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgcacaggatcttcgaaacaggctggcgattccggtgatcgggtcgccgctt
ttcatcatctccaacccgaaactggtcatcgcccagtgcatcgccggcatcgtcggctcg
tttccggcgctgaacgcccggccggcctcccaactcgacgaatggctggcggaaatcacc
gaaaccctggcggcgtgggaccgcgatcatccggaccgcaaggcggcgccgttcgcggtc
aaccagatcgtgcaccgttccaacgcgcggctcgaacaggatctcgaactctgcgtgaaa
taccgcgcgccgctggtcatcacctcgctcggcgcgcggccggaggtgaaccaggcggtg
catggctatggcggcatcgtgctgcatgacatcatcaacgaccgcttcgcccgcaaggcg
gtcgagaaaggggcggacgggttgatcgccgtggccgccggcgccggcggccatgccggc
acgctctcgcccttcgcgctggtgcaggaaatccgcacctggttccaggggccgctcgct
ctgtccggcgcgatcgcgaccggccgcgccgtgctcgccgccgaggcgatgggggccgat
ttcgcctatatcggctcggccttcatcgccaccgaggaggccaacgcggccagtgcctac
aagcaggcgatcgtcgccagcggcgcggaagacatcgtctacaccaatctcttcaccggc
gtgcatggcaactacctgcgcccgagcatcgtcgccgccggcctcgatcccgacaacctg
ccgcagagcgatgcctcggcgatgaatttccacgagggcgcgaaggccaaggcgtggaag
gacatctggggctcggggcaggggatcggcgcggtcgatgccgtgctgccggcaggcgag
cgggtcgcgcggctgatcgccgaataccgcgcggcgcgcgccgccctgtgcggctga

DBGET integrated database retrieval system