KEGG   Acidiphilium multivorum: ACMV_02920Help
Entry
ACMV_02920        CDS       T01446                                 

Gene name
asnB
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
amv  Acidiphilium multivorum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ACMV_02920 (asnB)
Enzymes [BR:amv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     ACMV_02920 (asnB)
Peptidases [BR:amv01002]
 Cysteine Peptidases
  Family C44
   ACMV_02920 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
337325..339070
Genome map
AA seq 581 aa AA seqDB search
MCGIAGLALKPGARIAPETLAALARALAHRGPDGAGTHVSERAALVHTRLAIVDLATGDQ
PLFGAGAALIGNGEIYNNRELRAALPLVPFRTGSDCEPPLHLARAEADFVPLLRGMYALA
IDDSERGVVTLARDPFGIKPLYRCAADQGTAFASEPQALLAAGLATRRIDTARLVELLQL
QFTAGTATVFTGIERVPPGALLTLRDGAEAALLDHPPIEPGEAPRDEDAALVALDAVLAQ
SVELHQRSDVPYGMFLSGGIDSAAILALMARLNETPVLAFTAGFDRATVADERDDAEATA
RAVGARHERIEITETMTWRHLPAIVAAMDDPAADYAIIPTWFLARHARGSVKVVLSGEGG
DEMFAGYGRYRAAARPWPFARPMRARGAFDGLDLLRDRGEGWRAGLLRARQAASGSGLAR
AQREDVATWLPDDLLLKLDRCLMAHGVEGRTPFLDREVARFAFALPDRLRARRGLGKYLL
RKWLEANLPAARPFARKQGFDVPVAAWIAGQGQRLGELVARAPVIAEVADPARVRDLFAR
AADRRAGVACWRLLFLALWHHRHGLGGAVDGDVFEILGERA
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcgccggactcgcgctgaagccgggggcgcggatcgcgccggaaaccctc
gcggcgctcgcccgcgcgctggcccatcgcgggccggatggtgcgggcacccatgtcagc
gagcgcgcggcgctggtgcatacccgcctcgccattgtcgatctcgcgaccggcgaccag
ccgctgttcggtgccggtgccgcgctgatcggcaatggcgagatctacaacaaccgcgaa
ttgcgcgccgccctgccgcttgtgcccttccgcaccggcagcgattgcgagccgccgctg
catcttgcccgcgccgaggcggatttcgtgccgctgctgcgcgggatgtatgcgctcgcg
atcgatgattccgagcgcggcgtggtgacgctggcgcgcgatccgttcggaatcaagccg
ctctatcgctgcgccgccgaccagggcaccgccttcgcctccgagccgcaggcgctgctc
gccgccgggctcgcgacgcggcggatcgacacggcgcgcctcgtcgagctgctgcaactg
caattcaccgccggcaccgcaaccgtcttcaccgggatcgagcgggtgccgcccggcgcg
ctgctcaccctgcgcgatggcgccgaggcggcactgctcgaccatccgccgatcgagccg
ggcgaggcgccgcgcgacgaggatgcggccctcgtcgcgctcgatgccgtgctggcgcaa
tcggtcgagctgcaccagcgcagcgacgtgccgtatggcatgttcctctcgggcgggatc
gacagcgccgcgatcctcgccctgatggcgcggctgaacgagacgccggtgctcgccttc
accgccgggttcgaccgcgccacggtggccgacgagcgcgacgatgccgaggcgacggcc
cgcgccgtcggcgcccggcacgagcggatcgagatcaccgagacgatgacttggcggcac
ctgcccgccatcgtcgccgcgatggacgacccggccgccgattatgcgatcatccccaca
tggttcctcgcccgccacgcgcgcgggagcgtcaaggtcgtgctgtccggcgagggcggg
gacgagatgttcgccggctacggccgctatcgcgcggcggcgcggccctggcccttcgcc
cggccgatgcgcgcccgcggcgcgttcgacgggctcgacctgctgcgcgatcgcggcgag
ggctggcgcgccggtctcctgcgggcgcggcaggcggcaagcggcagcggcctcgcccgc
gcgcagcgcgaggatgtggcgacctggctgcccgacgatctgctgctcaagctcgatcgc
tgcctcatggcgcatggcgtcgagggccgcacgcccttcctcgaccgcgaggtggcgcgc
ttcgccttcgccctgccggaccggctgcgggcgcgccgggggcttggcaaatatctgctg
cgcaaatggctggaggcgaacctgccggcggcgcgtcccttcgcccgcaagcaggggttc
gatgtgccggtcgccgcctggattgccgggcagggccagcgcctcggcgagctggtcgcg
cgcgcgccggtcatcgccgaggttgcggacccggcgcgggtgcgcgacctgttcgcccgc
gcggccgaccgccgggccggcgtggcatgctggcggctgctgttcctcgccttgtggcat
catcgtcacgggctgggcggcgccgtcgatggcgatgtgttcgaaatactgggagaacgg
gcatga

DBGET integrated database retrieval system