KEGG   Acidiphilium multivorum: ACMV_06400Help
Entry
ACMV_06400        CDS       T01446                                 

Definition
(GenBank) putative transposase for insertion sequence element
Organism
amv  Acidiphilium multivorum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
724251..725597
Genome map
AA seq 448 aa AA seqDB search
MPATVETTPCLPGLSPVAGKPVLARFDGEMLSSDGGLLALREVEKRLGIAAQLAACIDDP
RTPERVQHGLDEIIRFRMLMIAAGYEDGNDADRLRNDPMFKLAMERLPEAGDLCSQATIS
RTENLPGPRALLRMGLAMVEHYCASFRTIPNRVVLDIDDTFDAAHGAQQLCLFNAHHDEY
GFQPIVVFDGDGRMLAAVLRPACRPKGAQIVKWLRRLIDAIRSHWPRTAIMLRGDSHYCT
PEVLRFCRARRLDYIFGVAPTTTLRKHVIALEASTTARAQQAPGEKIRRFKEFNDGAASW
DRVERIIARVEAGPLGVDTRFIVTSLKAGSPRTLYQEIYCARGQAENHIKAWKTHLAADR
TSCSRASANQMRLFLHIGAYWLMWSLRSLMPRRSRWRGIQFDTLRLRLIKLAVRLETLKR
SIRLHLPRSMPDQAILGYALARLPRLVI
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccacggttgaaactaccccatgcctccccggtctgtcacctgtcgccggcaaa
ccggtgctggcccgcttcgacggcgagatgctgtcctctgacggcggtctgctggcattg
cgcgaggtcgagaagcggctggggattgccgcgcagttggcggcctgcatcgatgatccg
cgcacgccggagcgtgtccagcatgggctcgacgagatcattcggtttcgcatgttgatg
atcgcggccggttacgaggatggcaacgacgccgaccggttgcgcaacgacccgatgttc
aaactcgcgatggagcgtctgcccgaggcgggcgatttatgctcgcaagcgacgatttca
cgcaccgagaatttgcccgggcctcgcgcgctgctgcgcatgggcctggcgatggtcgag
cattattgcgcgagttttcgcaccatacccaaccgggtcgtgctcgatatcgacgatacc
ttcgatgccgctcacggcgcgcagcaactctgcttgttcaacgcacaccacgatgagtac
ggtttccagccgattgtggtattcgacggcgacggccggatgctcgccgcggtgctgcgt
ccggcgtgtcggccaaaaggggcccagatcgtcaaatggttgcgccggctgatcgacgcc
attcgcagccactggccccgcaccgcgatcatgctgcgcggtgattcgcactactgcacg
ccggaggtgctgcggttctgtcgggcgcgtcgcctcgattacatcttcggcgtcgcaccg
accacgacgctgcgcaagcacgtcatcgcgctggaggccagcaccacggcgcgcgcgcaa
caagctccgggagagaaaatccggcgcttcaaagagttcaatgatggcgcagcaagctgg
gaccgcgtcgagcggatcatcgcccgcgtcgaggccgggccgctgggggtcgatacccgc
ttcatcgtcaccagcctgaaggctggttccccgcgcaccctgtatcaagagatctactgc
gcgcgcggccaggccgagaaccatatcaaggcgtggaagacccatcttgccgccgaccgg
acctcgtgctcgcgggccagcgccaaccagatgcgcctgtttctgcatatcggcgcctac
tggctgatgtggagtttgcgctccctgatgccgcgccggtcgcgctggcgtggtatccag
ttcgataccctgcgcctgcgcctgatcaaactcgccgtccgcctcgaaaccctgaaacgc
tcgatccgcctgcatctgccgcgctcaatgccagaccaggcaatcctcggctacgccctg
gccagactgcccaggctggtcatctga

DBGET integrated database retrieval system