KEGG   Acidiphilium multivorum: ACMV_06430Help
Entry
ACMV_06430        CDS       T01446                                 

Definition
(GenBank) beta-glucosidase
  KO
K05349  
beta-glucosidase [EC:3.2.1.21]
Organism
amv  Acidiphilium multivorum
Pathway
Cyanoamino acid metabolism
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACMV_06430
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    ACMV_06430
Enzymes [BR:amv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     ACMV_06430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(728262..731045)
Genome map
AA seq 927 aa AA seqDB search
MRRMPLAALLSLSAIVAVRAAHAAPQAAGCAWRNDHLSTARRTALLLHALTPGDETDLIA
GAGTHEPYVFYTRGLKRFCIPPMGLEDGPAGVGDKLGGVTALPAGVALAATWDPSLARRY
GAVIGAEQKAKGTAVDLGPTVNIDRDPRWGRSFESLSEDPYLAARIGVAEIRGIQSTGVM
AQVKHFAVYNQETYRNTPEDDVIVSPRALHEIYLPAFRAAVRRAHVASIMCGYATIGGHE
SCGDKALLTGVLRADWGFRGFVTSDYQAIHATADAAAGADMEQPFATYFGARLTQAVAAG
KLARSVPETMTRHILAEMFRFRLFDHPPQGSTTAIVATRADRLAATRIAEAGTVLLKNDG
NVLPLDPGHGGTIAVIGPAASIQPVYAGGGSANVVPMQPVPPLAGIDHAPGMTRHVDYVA
GLPADKALTPIPPSALSGPFRPTPLHGSFQAVLTAPETGTYVLGITNPCHCYAPTDLSLD
GRELLSDPGTPPVSTYSAAVQLRKGERYRLGVTGAASRLTWATPSTLRPDIARAVAAARR
AAVAIVVVADDTESEAADRPDLDLPSAQNRLIEAVSSANPHTVVVIDAGAPVAMPWLGKV
AAVVDAWYPGETNGTALAAILFGKADPGGHLPVTFPAHLADMPTAPVARFPGTGGRVDYS
EGIDVGYRWYSAHHVRPLFPFGFGLSYTHFAFSDLKVVSGPGDGTRPVVVSALVTNAGKV
AGSDVAQLYLRFPRSAGEAPLKLVGFRRVRLAPGQSKRLRFTVTPRQTWWWHGSGWTASP
GTYRLYLGDAADDAHLAQRVSFPMPQTVGARNVLVEAPEQAIPGQPVKVKVSLSAGGEAT
LRHVRLRLDAPAGWRVSAIGSAAGEGIQPGEAVRATFTVTSPGWAAAGTYALRAVAQLGA
RHCTRGADAGCVTATRDSGAMITLAAR
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atgcgccggatgccccttgccgctctactgtccctctcggcgatcgtggcggtccgcgcc
gcccatgccgccccgcaagcggcgggatgcgcctggcgcaacgaccatctttcgacggca
cgccgcacggcgctgctgctccatgccctgacgcccggcgacgagacggatctgattgcc
ggagcgggaacgcatgaaccctacgtgttctacaccaggggactcaagcggttctgcatt
ccgcccatgggtctcgaggatgggccagccggtgtcggcgacaagctcggcggcgtcacg
gccctgcccgccggcgtggcgctcgccgcgacctgggatccgtcgctcgcgcggcgctac
ggggcggtgatcggcgccgagcagaaggcgaagggaaccgccgtcgatctcgggccgacc
gtgaacatcgatcgcgatccgcgctgggggcggtctttcgaatccctctcggaagaccct
tatctggccgcccggatcggcgttgccgagatccggggcatccagtccaccggcgtcatg
gcgcaagtgaagcacttcgccgtctacaaccaggagacctatcgcaacaccccggaggac
gacgtcatcgtctcgccccgcgcgctgcatgaaatctacctccccgcctttcgcgccgcc
gtgcggcgcgcccatgtggcctcgatcatgtgcggctatgcgacgatcggggggcatgag
agttgcggcgacaaggcgttgctgaccggcgtgctgcgcgcggactggggattccgcggc
ttcgtcacctccgactatcaggccattcacgcaacggccgacgcggccgccggcgccgat
atggagcagcccttcgcgacctatttcggcgcgcggctgacgcaggcggtcgcggccgga
aagctcgcccgcagcgtgccggagacgatgacgcggcatatcctcgccgaaatgttccgc
ttcaggctgttcgatcatccgccccagggcagcaccacggccatcgtcgcgacccgggcg
gatcgcctggcggcgacccggatcgccgaagccgggacggtgctgctcaagaatgatgga
aacgtcctgccgctcgatccgggccatggcgggacgatcgcggtcatcgggcccgccgca
tcgatccagcctgtctacgccggcggcggcagcgccaacgtggtgcccatgcagccggtc
ccgccgctcgccggcatcgatcacgcgccggggatgacgcgccacgtcgactacgtggcg
ggattgcccgccgacaaggcgctgacgccgatcccgccctcggcgctttcgggtccgttc
cggcccacgcccctgcacggttcgttccaggccgtgctcaccgcgccggagaccggcacc
tacgtgctcggcatcaccaacccgtgccattgctatgcgcccaccgatctctcgctcgat
ggcagggaattgctgagcgatcccggcacgccgccggtttccacctattccgccgcggtg
caactgcggaagggcgagcggtacaggctcggcgtcaccggcgccgcgtcgcgcctgacc
tgggccacgccatcgaccctgcggcccgatatcgcgcgcgcggtcgcggcggcgcgacgg
gccgccgtcgccatcgtggtggtggcggacgacaccgagtcggaagcggcggacaggccc
gatctcgacctgccatccgcccagaaccgactgatcgaggcggtgtcatcggcaaatccg
cacacggtcgtggtcatcgatgccggagcgccggtcgccatgccctggctcggcaaggtc
gccgcggtcgttgatgcgtggtatccgggcgagaccaacggaacggccctggccgcgatc
ctgttcggcaaggccgatcccggcgggcacctgccggtcacgttccccgcacacctcgcc
gacatgccgaccgcgccggtggcgcgctttcccggcacgggcggcagggtcgactattcc
gagggaatcgacgtcggctatcgctggtattcggcgcatcatgtcaggccgctgttcccg
ttcgggtttggcctctcctacacgcatttcgcgttcagcgacctgaaggtcgtctccggc
cccggcgacgggacacgcccggtcgtcgtatccgccctcgtcacgaatgccggcaaggtt
gccggcagcgacgtcgcccagctctatctccgcttcccgcgcagcgcgggcgaggcgccc
ctcaagctcgtcggcttccgccgcgtccggcttgctccggggcagtcgaagcgtctccgc
ttcacggtgacgccgcgacagacctggtggtggcacggctcgggctggacggcctcgccc
ggcacctatcggctgtatctcggcgatgccgccgacgatgcccatctcgcgcaacgcgtt
tcgttcccgatgccgcagacggtcggcgcccggaatgtgctggtcgaggcgccggaacag
gccatccccggccagcccgtcaaggtgaaggtgtcgctctcggccggcggcgaggcgacg
ctccggcatgtgcggctgaggctcgacgcgccggcgggatggcgggtttccgccatcggt
tccgcggcaggggaaggcatccagcctggagaggcggttcgcgcgaccttcacggtcacg
tcccccggctgggcggcggcggggacctatgcgctgcgggcggttgcgcaactcggcgcg
agacattgcaccaggggggccgacgctggatgtgtcacggcgacgcgggacagcggcgcg
atgatcacgctcgcggcccgatga

DBGET integrated database retrieval system