KEGG   Acidiphilium multivorum: ACMV_06440Help
Entry
ACMV_06440        CDS       T01446                                 

Gene name
bcsA
Definition
(GenBank) cellulose synthase catalytic subunit [UDP-forming]
  KO
K00694  
cellulose synthase (UDP-forming) [EC:2.4.1.12]
Organism
amv  Acidiphilium multivorum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACMV_06440 (bcsA)
Enzymes [BR:amv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.12  cellulose synthase (UDP-forming)
     ACMV_06440 (bcsA)
Glycosyltransferases [BR:amv01003]
 Polysaccharide
  Structural polysaccharide
   ACMV_06440 (bcsA)
Transporters [BR:amv02000]
 Other Transporters
  Others
   ACMV_06440 (bcsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(731055..733331)
Genome map
AA seq 758 aa AA seqDB search
MMRHLPALTNGLTFIVASAVGFVLIAATLLPTTGPLPDIEQGVVFGLLLILYNLDGGCRS
RRKRPIVRISISALTILLTCRYLDWRLTDTLPFGFGTINIALGILLVLAELHGIGSAIMG
QIINVLPLDRTPQHFTLDPASCPTVDILIPTYNEDPEIVETTVIAATQIDYPASRFRVYI
LDDGGTDAKRAKPGAAGREAARRAETLREIARKFGAIYLTRPENVHAKAGNINHALGQID
GELILVLDCDHVPTRDFLSRTVGFFQADPKLFLLQTPHNFVTPDPIERNLSTFEVMPAEN
ELFYHVMQPGLDFWGAAFFCGSAAVLRRHVLDEIGGISGKSITEDAETTVKAMCRGYRTA
FYNRPMVSGLQPETFSGFILQRVRWAQGMMQIFMLDNVWLKSGLTFMQRLLFTNFAFYWL
FPISRSILLLMPPLFLFFGFNVAATTPRQLLVYALPYYLAALVNSQYFYGRVRWPFISQV
YETAQTVFLSAALVSVLRRPRAPKFKVTPKGEMLDKDFISGLSWPFYWLFALACASLGIG
LWRIVTQPQLRWALIFVVFWVVLDMIALLGVIGALAERRQTRTMPRIGCKGPAWMHRDGG
GWVEAALHDLGRGGAGLVLAAGTEGPQPGDRVRLHVPGLRGGLPAVVRHRKDGARNSIIG
LQYVSDGVAEARAAVDRAFGDSELLVRNAALRHRGTSIAYAFGFLFAIGLRGTARHFRIL
ARDAAITLRVSRQRRALLASSRQAEENGGQKARLAPLS
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgccatctccccgcgttgaccaatggcctcaccttcatcgtcgcctcagccgtg
ggcttcgtgctcatcgccgccacgctgctgcccacgacggggcccctgcccgatatcgaa
cagggcgtcgtcttcggcctgctgctgatcctctacaatctcgatggcggatgccggagc
cggcgcaagcggccgatcgtgcgcatctccatcagcgccctgaccatcctgctgacgtgc
cgttatctggactggcggctgaccgacacgctgccgttcgggttcggcacgatcaacatc
gccctcggcattcttctcgtgctcgccgaactgcacggcatcggctcggccatcatgggg
cagatcatcaacgtgctgcctctcgacaggacgcctcagcatttcacgctcgaccccgcg
tcctgccccaccgtggacatcctcatccccacctacaacgaggatcccgagatcgtcgaa
accacggtgatcgcggcaacgcagatcgactatcccgcttcgaggttcagggtctacatc
ctcgacgatggcggcacggatgcgaagcgcgcgaagccgggcgccgccggacgggaggcg
gcgcggcgggcggagacgctgcgcgagatcgcgcggaaattcggcgcgatctatctcacg
cggccggaaaacgttcacgccaaggccggcaacatcaatcacgcgctcggccagatcgac
ggcgagctgattctcgttctggattgcgaccacgtgccgacgcgggacttcctttcgcgc
accgtcgggttcttccaggccgatccgaaactgttcctgctccagacgccgcacaatttc
gtgacgcccgatccgatcgagcgcaatctttcgaccttcgaggtgatgccggccgaaaac
gagctcttctaccatgtgatgcagcccggcctcgatttctggggggcggcgttcttctgc
ggctctgcggccgtcctgcggcgccatgtcctcgacgagatcggggggatctcgggcaag
tcgatcaccgaggacgcggaaaccaccgtgaaggcgatgtgccgcggctaccggacggcg
ttctacaaccggccgatggtctccggcctgcagccggaaacgttctccggcttcatcctc
cagcgggtgcgctgggcgcagggcatgatgcagatcttcatgctcgacaatgtctggctg
aaatcgggcctgaccttcatgcagcggctgctgttcaccaacttcgccttctactggctg
ttcccgatctcgcggagcatcctcctgctgatgccgccgctgttcctgttcttcgggttc
aacgtcgcggcgaccacgccacgccagttgctggtctatgccctgccctactacctcgcg
gcgctggtcaacagccagtatttctacgggcgcgtgcgctggccgttcatttcccaggtc
tacgagacggcgcagaccgtctttctttcggcggccctggtctcggtgctgcggcggccg
cgcgcgccgaaattcaaggtcacgccgaagggcgaaatgctggacaaggatttcatctcc
ggcctgtcctggcctttctactggctgtttgccctggcctgcgcctccctcggtatcggg
ctctggcgcatcgtgacccagccgcagctgcgctgggcgctgatcttcgtcgtgttctgg
gtcgtgctcgacatgatcgccctgctcggcgtgatcggcgcgctggcggaacggcgccag
acgcgcacgatgccgcgcatcggctgcaaggggccggcctggatgcatcgcgacggcggc
ggctgggtcgaggcggcgttgcacgacctcggccgcggcggcgccgggttggtccttgcc
gccggaacggagggcccgcagcccggagaccgtgtgcgcctgcacgttccgggcctgcgc
ggcgggcttcccgcggtggtgcggcaccgcaaggatggcgcacgcaacagcatcatcggg
ctgcaatacgtatccgatggtgtcgccgaggcgcgggccgcggtggaccgggcgttcggc
gacagcgagctgctcgtccgcaacgccgccctccggcaccggggcacgagcatcgcgtat
gccttcggctttctcttcgccatcggattgcgcggtacggcgaggcatttccggatcctc
gcacgcgacgccgcgatcacgctgcgggtgtcgcgccagcgccgggccctgcttgccagc
agccggcaggccgaggagaacggcggccagaaggctcgcctcgcccccttgtcatag

DBGET integrated database retrieval system